CAZyme Information: KIW15114.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW15114.1
• CAZy Family: GH20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	KN847496|CGC9	47147.13	6.1772

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847496:3683438-3684679(+)

Full Sequence      

MADPKSYSDDHSSHADDDADIGLTPLSHKPTEEPLLTKDEPPIFLRLYRRRNTKRRLCIA
LVLVTTLFCVALVGIGGVPDSVPRPNLKMLEKPRWNVKNFKSLITFGDSYTDEGRYHYWY
QHNKTYPPVGTFFPSSKQTRNWARYTIQYTGSSNGEEWKPQMTLYDYAFGGSWCSDEIIP
RGPKKASVLEGGVPAFLNDLTAARAGTEEPYFQPSITASNAVFVIWIGTNDLGNFAYLSN
EQTPGKFLADFNECVFRSVDKLYAAGARTFVLMNTVPLQLTPLYSIKLPSGEEKVRDRWM
APKAIEITKVVNDIYRYQTPYEFAVSNRYPDARVALFDVNSLMTDMYFSPEFYFNGTAPA
NVTSFYTKTQEDRLNPDSFMWRDDLHPSEQTHRNIAAELVRVLDGTSDYAQYW

Enzyme Prediction     

No EC number prediction in KIW15114.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	103	399	1.2e-53	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	5.67e-49	102	402	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238883	Triacylglycerol_lipase_like	3.78e-12	100	396	1	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	2.21e-11	103	399	1	224	GDSL-like Lipase/Acylhydrolase.
238875	SGNH_plant_lipase_like	1.87e-10	219	399	128	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	1.54e-09	96	396	25	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14322.1|CE16	1.52e-81	79	413	22	357
QKX58204.1|CE16	3.54e-74	94	413	20	348
BCS15697.1|CE16	4.22e-74	94	413	24	354
BCS04097.1|CE16	4.22e-74	94	413	24	354
QMW44554.1|CE16	2.73e-71	90	413	19	353

PDB Hits     

KIW15114.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	5.62e-53	99	413	26	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|T2FKR1|AES1_THETO	2.18e-12	101	282	32	198	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|G2QJ27|AES1_MYCTT	7.15e-12	101	282	32	198	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999866	0.000144

TMHMM  Annotations     

Start	End
57	79