CAZyme Information: KIW15022.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW15022.1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	KN847496|CGC19	47182.85	6.2625

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847496:3427619-3428890(+)

Full Sequence      

MVALGSERSSRGVFTRAFYRCLPLLVALGLFFSFHNLFGSSSYRAIGGPFPQKIWQTWKT
DAAGLDAKDAVRVRTWTTKNPQHRYELLTDDNAMSYVKHHYGPNGINRPDIVHIYETLQL
KIIKADLLRYLVMYIDGGLYADIDVECLKPIKDFIPNRYQEKDIDMVIGIETDMPDFKGH
PVLGQKSQSFVQWTFMGKPGLPVMMRLIENIMKWLNTVSKEQDKPISQIHLDFDEVLIGT
GPSAFTSAVLAEMSIAAGREVLWDEFHNMLDSKVVAGVLVLTSEAFAAGTGHSASGNHDG
KSALIKHHFHASSWPTNHPRFKHPLYGEVERCNWDQECVKLWDSNTAFFNSLPEEEQLKL
VHMKQVEDKKHPPKIDEQGPIGGMAPVAGMPPAEELEAAGAGAEADPKAAAAPAEEEAKG
EKQ

Enzyme Prediction     

No EC number prediction in KIW15022.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	73	157	9.4e-21	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.89e-26	49	215	81	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.74e-12	73	157	8	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX62098.1|GT32	3.09e-154	2	368	3	373
SMY25259.1|GT32	2.09e-153	20	369	29	383
SMR53774.1|GT32	2.09e-153	20	369	29	383
SMQ51614.1|GT32	2.09e-153	20	369	29	383
SMR56074.1|GT32	2.09e-153	20	369	29	383

PDB Hits     

KIW15022.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.97e-31	51	314	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	6.16e-29	50	286	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	5.48e-26	49	314	98	375	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.99e-22	49	314	95	469	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.76e-08	36	195	43	193	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000010	0.000009

TMHMM  Annotations     

Start	End
21	43