CAZyme Information: KIW14988.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW14988.1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		37625.46	4.8933

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847496:3336365-3337384(+)

Full Sequence      

MANASDPVKDNLHDVFNETLGFGKIYVVSMPERSDKRDTISVQARLTGMSFDFVDGVAGA
KVLEKALPYTMNRTGPEIGCWRSHLNAMQEMVRQKIRSALIFEDDADWDVALKAQMLQVA
RGSRWLLGNPKDAIPYSPYGDGWDVLWIGHCSSEPSGSRRWVIPRDPTVVPPSDRGYWFK
PDMTTWESGADPDTQTRLLFEVGLGSCSAAWAISLAGAEKILYQLSMSPFNDAIDMGVSD
MCFRKTLNISCIAPFPTIIGVSKPAGSLERGSDIRDDESNTHTEQGIRPTSESERVVFST
RQNIERLITKQDTFESRYPDVTGQFMSLKDIGSAIGHGE

Enzyme Prediction     

No EC number prediction in KIW14988.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	24	236	9.6e-26	0.9723756906077348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	3.71e-26	24	109	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	3.92e-10	22	106	1	96	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
225843	COG3306	5.34e-10	21	106	1	97	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10899.1|GT25	4.70e-70	12	320	51	353
BCR98565.1|GT25	1.48e-69	12	320	93	395
CAP93867.1|GT25	2.95e-67	15	318	60	360
AUW31129.1|GT25	4.63e-67	10	324	61	379
CAK38229.1|GT25	7.84e-66	12	320	363	665

PDB Hits     

KIW14988.1 has no PDB hit.

Swiss-Prot Hits     

KIW14988.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIW14988.1.