CAZyme Information: KIW14305.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW14305.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	KN847496|CGC13	91087.62	5.2896

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847496:1466617-1469166(-)

Full Sequence      

MHTAHLLATLVTLYLGILYADGRAFSPWSRDGSFNPGNASKYKGDDLAPVYYAVGPEPTI
NTTVAWTASTIISLNASSTVATLDYGSEAAGIPFIYVQSLSGPAQLELRYGEQFPALQNP
NGDGPWTFINGLTNTFRTETLNITTTGRVESFFVQGGQRWQSVRLLTEAPISLSAGLRLT
SDHLAPAQLSGRFSASNPLYEEIFDLGGRTVQAACIDRGAAPSVWEVTSDGVRVRGQQTS
QSIVGINFSNYTISFMTKVIQSGTAFRVASGVFPYGAYFVLTTQSTPYLDTNRTVLPANS
LIWNYGWSMVNQSTLAVPAVHVLPLKTPIVPDTWYNIALEITSTGYNISLDGRSLAFISS
EEILALLNPLWGSPTWYSGTWGFGPFQGQDAFFKDVKVIAKNGTVLYNNSMMSSDVLAEY
SVLPNPNPVCMDGAKRDRLVWVGDFAHTCRVVLHSTNRLDYLRGSISQALAWASDHGPTA
GFVGMDSPLGTTALSKAAYSDHLYSLFDYQDLFILALGDYYWATGDLAFIKAHWSQIGAA
VDGRLTLNNPTTSLSETPDIQGIYFLGPANGSAASAVNVLALQRAASLASAVGDVASVHK
WTAVAQSISTAINSLLWNPESGVYSLSTAYPDDFSLAAIAFTIRAGIANATQAAAMIQKV
PQLRLGIGFKDSSMVNSTATTQLSPNTQGFLLEALFLAHRDFGTPLDSARVLLDTFWAAM
VTQNQYYSGASWEYTYPDGSPGIDLFTSLSDPWGAAPTYLLSEYVLGISATKPGYTSWSM
QPLVEGLGLTHASGTVPTPSGPIEANWHIVGNNATICVSAPKVSRGQIVFGGQKFAVSGG
QQHCVNVAL

Enzyme Prediction     

EC	3.2.1.40:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	418	828	5.1e-53	0.746031746031746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	2.48e-06	767	821	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	5.82e-04	519	628	109	225	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY00141.1|GH78	2.43e-231	52	822	44	801
USW53135.1|GH78	2.37e-229	46	829	22	796
BCR89915.1|GH78	2.26e-224	50	828	27	814
QKX57645.1|GH78	3.43e-216	43	815	33	820
BCS19496.1|GH78	1.14e-215	69	828	41	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.74e-12	431	820	331	685	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

KIW14305.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999755	CS pos: 22-23. Pr: 0.9831

TMHMM  Annotations     

There is no transmembrane helices in KIW14305.1.