CAZyme Information: KIW14086.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW14086.1
• CAZy Family: GH16
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D1YGG6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	KN847496|CGC6	56436.91	6.0003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847496:779214-780907(+)

Full Sequence      

MPFRERIKELCGGCFREPTTGEDLQQPPPLPVPLPDVGKDGIYSPSLSFISETSTRSTYC
PRTEETVPISTISTYIKAINILSSLHLAPLAFMILVLSNLIAVNAFSCDHIGNLAVVTSA
NRLSERDGPGIEPGEPREVRKGYIVGPPWSYLFYPPPPFGYSTVPGISSFPRSTQSPAPL
TTTPSAPSITNTSSTSVVVYPTTTISPYPLSSPSASPASGVSPTSASRSTSVPDRASFSP
TIPGTASSSRTSSSSSTKSVATTNTSAPIQTSNVVQVGNQWLVPEAGIFDNRASFTFGNG
FPDGLQISNYSNHQRGSGPSPEVPYNPKFDPANVHIMDGMLALTVPGHQRPNKHNGWALS
SAEVTTVKENILHGSVRTRAILSKVPGTCHGFFFYRSDTQEIDIEYLTDPSSLSNNGPGK
RIPMHYTNQAVDPEDEPETQATGTSPLDCTTAVHEYRIDWTSDYTAFYLDGKLQKKFTTN
VPSESGPWVWNNWANGNKGWSVGPPSSDNILLIKSIEMYYNTD

Enzyme Prediction     

No EC number prediction in KIW14086.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	341	519	1.3e-43	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.71e-38	329	519	27	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185693	GH16_laminarinase_like	2.82e-07	298	491	7	198	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185684	GH16_lichenase	1.05e-05	324	473	24	160	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	6.76e-05	329	480	1	131	Glycosyl hydrolases family 16.
185692	GH16_fungal_CRH1_transglycosylase	1.85e-04	397	473	70	137	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI62369.1|GH16	2.80e-57	278	522	36	262
QPC59862.1|GH16	7.95e-57	281	522	40	263
QPC71194.1|GH16	1.56e-56	281	522	40	263
QGJ01524.1|GH16	2.13e-56	281	522	39	262
QGI70634.1|GH16	2.13e-56	281	522	39	262

PDB Hits     

KIW14086.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45797|GUB_PAEPO	4.18e-07	298	493	27	208	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KIW14086.1.