CAZyme Information: KIW12903.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW12903.1
• CAZy Family: GH12
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D2B1W8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780	KN847497|CGC11	88797.67	6.7453

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847497:472504-475061(+)

Full Sequence      

MDLLLCKKEKILLILVEDYQVLMKRGWYVEDLLIEHIYGNQALESYPQTALTGSRSATEH
FNSRVQDQRRSNTQLLPCVPEAALKDPATKEKISVIQAALHKEEHADEILAPEEEGREAP
KRRLLLRHATMVSMAIILVVVVEMACVAKMVSEVQLDRSFTRFALLAVVPIFGIYSLFFM
IVVSGSLWQIFGSLSSLKQNTRYYSAIAPKPGRYPDLELPHITIQMPVYKEGLQGVIIPT
ITSVAKAVKHYEAQGGSASIFVNDDGMQLVSEDLADARKAYYELNNIGWCARPPHKEKGK
KKGKKAWGRKSEKTHDEEAGIATAYFLRKGQFKKASNMNYCLDFSLRVDDQYLSMVKTIC
EERGCTSDELSSEDEQQIYQQARDRVIADDEGRTWAAGDVRIGPIILIIDSDTRVPEDCL
LYGALEMHESPEVALIQHASGIMQVVHNAFENGITYFTNLIYTSIQFAVGMGDCAPFVGH
NTFIRWDALQSVAWYDEEDKCTKFWSDSHVSEDFDVSLRLQMNHFVVRLATYHEGGFKEG
VSLTVYDELARWEKYAYGCNELVFNPLYKWPYKGPFTRLFWRFLFSNVKITSKITILSYI
GTYYAVASALPLSLVNYLVVGWYANEIDQFYVTSWKVWVGMVVVFNLLSPIGYAMLRHRL
GKQTFFQSLFESIKWAPMFLLFFGGISFHLLKALLCHFFNIKMEWTTTAKEYNGGFRIGL
DRIVRDFKWMYGVIMLLAGGMIYLACFAPYGWTITDFSVIVPLANQVGCHALMPFALGLF

Enzyme Prediction     

No EC number prediction in KIW12903.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	405	643	2.1e-51	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.97e-50	405	620	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	7.00e-11	403	513	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	3.77e-08	395	711	131	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW95398.1|GT0	0.0	5	780	170	921
APA12832.1|GT0	0.0	7	780	188	938
ATZ55570.1|GT0	0.0	7	780	188	938
QSZ28760.1|GT0	2.27e-311	7	755	188	913
QKD61408.1|GT0	3.00e-257	88	779	261	967

PDB Hits     

KIW12903.1 has no PDB hit.

Swiss-Prot Hits     

KIW12903.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
129	151
163	185
599	621
634	656
679	701
732	754