CAZyme Information: KIW12671.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW12671.1
• CAZy Family: CE9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689		77593.59	8.1927

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847498:2583772-2586182(+)

Full Sequence      

MDYGQHAVSHVDWQDWIDLEAGSRADQPGRQPERSGTKPPLSSASLGSPRRFSLPEAPIP
FPEDAVLADGGRILDIQRPRSNSLPYSSISSLDEKIQFPEVRNAIITPSPFAAESNLSAL
PQVATLVGEQIVEEPSGDLTCERNPSRASIRSLENYYKKKRVKFRGKKRSKFAQILFQYS
IYLLLGCIIYFVLVGIPLWKGSVWWLWWAMKYKMVVKGGTSIFISVAFFYAIGTLFVRYE
PDPTPPRPEELQAVLEKNSSTALIIACYKSAEIIGRTLEAALQIFPPENIFVVANGNSPT
PLDNTEEVCQQYGVNHVWVPIGSKIVAQFVGVYAAHRSQYVLMIDDDCALPAGFPIVSER
IQRGKGKGLVKCVGYTIKAVGPDGTKGNIVQQLQDMEYKLSGMARKWMATWGTATFAHGA
IALWDRDFILKCFRHHPGFKISEDWFFGLTCRTLGGRIVMCSSVLVETEVPSGLFIGGGA
RGGFGEMTVYKQRFFRWNFFFLFRNWHTIKHILFDWNLGIYSIGDKVYTFQEIYTTLLYV
IGPILLVLSFMIEPEFTAIITGAMLGMYFSIAMIFNEVILRKKGEMVSRKVVILYYMPYK
MVLRLMNIVSVYYSAFTYAKYFAVRHLSIIEDEQVIELVIHSKPTVSQGTSTSVGESRNP
APEGVDAQDWSSDPFTFSPERDSHMNNDS

Enzyme Prediction     

No EC number prediction in KIW12671.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	261	472	4.8e-22	0.9173913043478261

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	1.93e-23	261	472	4	215	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
224136	BcsA	3.16e-16	222	637	18	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.41e-12	263	431	1	168	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
132997	Glyco_tranf_GTA_type	9.77e-08	264	354	2	94	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
404513	Glyco_trans_2_3	3.50e-06	340	474	1	128	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44102.1|GT2	1.45e-189	142	647	158	663
BCR93365.1|GT2	4.38e-189	142	645	158	661
BCS06011.1|GT2	4.38e-189	142	645	158	661
UPL00273.1|GT2	2.42e-181	152	640	172	654
CAE7014388.1|GT2	5.08e-177	80	640	162	734

PDB Hits     

KIW12671.1 has no PDB hit.

Swiss-Prot Hits     

KIW12671.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

Start	End
533	552
557	579
591	613
176	198
218	237