CAZyme Information: KIW12670.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW12670.1
• CAZy Family: CE5
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D2B239]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		41037.90	5.4074

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847498:2581631-2582740(-)

Full Sequence      

MVSLSVALIALLSLQSRASQLPERRSPLFPRASSPSSSKCDLYVVSGQDTTKFEHYTFSD
FRALSNYSINEPPSVTAEEDQGQENITSPYFAQPPFSDQWEIRRGIRNAESTVPMIYSAS
NVYITKDPGSGGSETYLTLRTTRLQDFQSVVQLVSVPDLLHASMRTRMKILPDGKDGKNV
ARGAVVGFFTYESDTQESDIEILTRDPLDTVQLTNQPASSTTPGASFDSTIPHGKHWTDW
TEYRIDWFPGRTLWYLDGKMVFNTTDSVPTDPSNLMFNLWSNGQSFSGTMRVGREVYVAV
QWIEMAYNLNGQGQSSNQTDGKTQCSVDSVHTKGVPEVIKSSSAKHRAVSRLLDTINSVL
FVLIACYCV

Enzyme Prediction     

No EC number prediction in KIW12670.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	99	305	5.8e-65	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	7.64e-46	95	305	8	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.80e-11	183	303	82	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	1.07e-05	182	280	46	150	Glycosyl hydrolases family 16.
225182	BglS	1.70e-05	166	345	123	307	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185692	GH16_fungal_CRH1_transglycosylase	1.34e-04	180	285	56	169	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO63760.1|CBM1|GH16_22	8.54e-62	36	343	31	346
CEF84700.1|GH16_22	2.14e-58	31	346	20	365
AAT84251.1|GH16_22	2.14e-58	31	346	20	365
CZS72348.1|GH16_22	4.24e-58	31	346	20	365
QPC74272.1|GH16_22	4.84e-57	31	349	20	368

PDB Hits     

KIW12670.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q53317|XYND_RUMFL	2.49e-06	183	316	661	795	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999706	CS pos: 18-19. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in KIW12670.1.