CAZyme Information: KIW12161.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW12161.1
• CAZy Family: AA8
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D1YB61]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
915		102734.15	5.6877

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847498:1227448-1230254(-)

Full Sequence      

MASPPRTPRKLQKRRSTPIQPTDPPQKGRADPDSPSKALLQAGGSSSFAVVAGEDGLEPL
PEDSFTSPTAHLSVQVESQTDMFKCMVRLLYLRQQQLQNRWADEDSAEGILLKTGNGNYI
SQPRELAEACGGFSEQMRKLNVKVAMTVKTPVIQTFLATYKPPYVPYTQDQRISILDSIE
EVCQAHRHHYAVFVRSTGLLVVWDEDAVEITDRAIRIEKHLVDLVWAMSSEQERDIHTIE
SAEPPREDATASVVTAQPLPATPAEAETGAPEAPRQTLLWQALVVGCGGCLTVFCLSIGW
RNLAVEIKIDHSWTRLLLVVASPLQLWLGWFFFMTVVTTIAQLVGPVKQVFQNSKFYSAV
PTKRLRDNLPHVTIQCPVYMESLDSVISSTVASVNKAISTYELQGGSASIFINDDGMQLL
PEEEARRRVQFYEDNNIGWVARPKHAPNGNADGQGVFIRAGKFKKASNMNYCLSVSNRVE
DKMAEVERTPTWTQEDEDRLYTSAFEAIVKEDQGRSWGAGNIRMGDFILLIDSDTRVPED
CLLDAVSELTATPEVAIIQFSSGVLNVTTSFFERAITFFTNLVYTSIRFAVACGDVAPFV
GHNAMLRWSALQDVSYIDVDGTEKYWAENTVSEDFDMSLRLQSLGYIIRYSAYYGDGFKE
GVSLTVYDELIRWEKYAYGCAELLFHPFHKWPLHGPVTPLFRRFITSPISWMGKLTMMSY
MGTYFAIGSAWALTLLNYFLLGWFNGYLDKDYAESFNMYFGLVIVFQGAGTVSVAVLRYR
TENRSLFKCLVENMTWMLVLAVFLGGISLHVSGALLFYLFGIDKSWGATAKEANTDTSFF
REIPVIIRKFKFTFIYCILSVAMMMVLAGIGPLGKLVPDFWRIKSFIAIFPQGIMIVMHF
FLPLVLNPGLMLFTF

Enzyme Prediction     

No EC number prediction in KIW12161.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	528	744	2.3e-52	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	9.35e-51	527	744	1	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	6.55e-15	525	841	138	434	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	6.44e-11	525	634	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133043	CESA_CelA_like	2.39e-06	519	650	73	202	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133029	GT_2_like_c	2.85e-06	517	650	62	156	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW53192.1|GT0	1.52e-302	91	914	79	887
UJO15800.1|GT0	2.16e-302	61	915	51	888
SMY19115.1|GT0	3.64e-302	84	915	69	883
SMQ45410.1|GT0	5.16e-302	84	915	69	883
SMR41768.1|GT0	1.58e-297	84	915	69	900

PDB Hits     

KIW12161.1 has no PDB hit.

Swiss-Prot Hits     

KIW12161.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

Start	End
278	300
316	338
722	744
756	778
798	820
852	874
889	911