CAZyme Information: KIW11459.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW11459.1
• CAZy Family: AA6
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	KN847499|CGC5	59276.76	5.1857

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847499:1995190-1996836(-)

Full Sequence      

MRPSASGTRAWCSSLLLLVAAQTTTSFSPWTRSTALGVTVPASAEGASYGQSSSFASFSF
EPAFWVEFFGNASKPNTLTFELLSRIHERGGRPIIRPGGITMDSMIFDASAGDPERTTSP
SGGVYRTTVGPSYFHSWSNFPQGTKFVSTLNFGNDSLDIARDMALASVMYQQEKIEYFEL
GNEPTNYPSTRWDNSTAAYVQQWKQWTGEIDTAVNHTLGANASRLGSDRWWASSATTDKS
GLNVRPADIIPAGVDSADQVAEYSIHSYAFSTCDPGRAALATTQNILNHTELTTYADEEI
YPSAKAALDSGKPWVVGEFNSISCSGQPNVTDTFAQALWTVDVELIYAVRNASSVHLHQG
ATLVFQSDNQVNSAGSDGSPGYSTYDILYPRDSRKRGKARALPSFVSQLFMAEAFHTSQN
GAAGVRVKELKPPQGVDSARFAGYSFYVNGKLSKVALLNMKPLYANSTEDFSLDLNLGLS
GQAWVKRMTAPSVDETRSQNVTWAGQSFPNGEAIGKLEIEEVGKGGSVSVRGSEAVLIFL
DKNDVYGL

Enzyme Prediction     

No EC number prediction in KIW11459.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	53	362	1.6e-45	0.6791208791208792

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	2.50e-20	443	537	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.
395098	Cellulase	0.003	178	326	125	243	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW52916.1|GH79	2.75e-236	40	548	29	542
CAE7219672.1|GH79	2.94e-234	38	548	30	539
UJO18135.1|GH79	2.52e-233	13	548	6	537
VBB81107.1|GH79	6.10e-197	55	538	39	516
CDP29334.1|GH79	1.74e-196	55	538	39	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5G0M_A	1.37e-06	35	505	30	436	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	1.39e-06	35	505	30	436	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	3.23e-06	35	505	50	456	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	1.02e-34	55	537	53	527	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	9.75e-22	55	367	37	361	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.398095	0.601868	CS pos: 21-22. Pr: 0.5270

TMHMM  Annotations     

There is no transmembrane helices in KIW11459.1.