CAZyme Information: KIW11160.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW11160.1
• CAZy Family: AA4
• CAZyme Description: trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
902		101939.56	6.7901

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847499:1203648-1206419(+)

Full Sequence      

MPLEEPGIVEPADPSLPTTSYFSLPRKESTAEQKSPIESARSAGSGKERLRRLSLVNPEG
PDTFDVDPRTAHPALRLSGNVISATFCIPYQLTHGSQGEWGLSTRHGTSALFDSFAYLSS
EKSPWKHTLVGWTGEIQNKPEQTSMSILQSESASAATNMNTHASNPINKSAAPYPVNGAV
PHPHDPNPEHLSLSRAERTRLEKVLADHPKGRTLPVWLPDYRGDADDEFVFKDQGRWRRY
AEHELYTLFHYRQHGPDDGRAEKASWNDYLQMNQAFADRILQIYQPGDIVWIHDYHLMML
PSMLRQRIPNIYIGFFLHIPFPSSEYMRCLPRRKEVLTGALGATMIGFQSYSFSRHFNSC
CKRILGFESSSAGVDAYGAHVAVDVFPIGIDVASVQGAAFKDPVIEENMKALKQMYAGKK
IIVGRDRLDTVRGVSQKLMAFEMFLERYPEWRDKVVLIQVTSPTSVMEDKVDGAHKFELK
ISNLVSRINGKFGSLSHSPVQHYPQYLSSQEYFALLRIADVGLITSVRDGMNTTSLEYVI
CQRNHFGPLILSEFSGTAASLSNAIHINPWDLGRVADALKEALEMPESQKRHDHEKLYNY
VTTHTVSTWTKSFLTRLLINLTSLTQNDLTPALDRNRMISQYRAAKKRLFMFDYDGTLTP
IVKDPNAAIPSDKVLRTLKALAADPRNNVWIISGRDASFLEEWMGHISELGLSAEHGCFM
RRPGSEVWENLASSMDMGWQNEVMDIFRYYTERTQGSWIEKKRVALTWHYRQADPDFGAF
QARECRKALEDNVMKNWEVEVMSGKANLEVRPQFVNKGFIASRLINEYGYESGDPPEFVL
CLGDDQTDEDMFRALLKTELPKDHVFACTVGASSKRTLATWHLLEPSDVIASIAALNKQE
NL

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	75	617	3.2e-156	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	193	896	56	723	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	0.0	214	617	73	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	2.46e-178	215	617	77	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
177855	PLN02205	2.43e-166	240	890	152	838	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
215556	PLN03064	1.96e-164	201	863	155	817	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK47779.1|GT20	0.0	20	901	51	940
CAP86177.1|GT20	0.0	20	901	51	940
BCR91687.1|GT20	0.0	36	901	81	953
BCS16698.1|GT20	0.0	36	897	80	938
QMW46130.1|GT20	0.0	20	897	58	938

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	2.82e-155	75	618	27	524	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXN_A	1.50e-145	630	897	3	270	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	3.55e-140	630	897	3	270	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXI_A	1.79e-96	627	896	2	297	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5HUV_A	8.05e-96	245	617	97	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	1.79e-219	52	896	6	812	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|P31688|TPS2_YEAST	1.39e-216	81	896	16	846	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	3.48e-209	81	896	11	853	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|O14145|TPS2_SCHPO	2.20e-165	99	889	36	842	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54NU9|TPSB_DICDI	1.20e-164	237	855	139	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIW11160.1.