CAZyme Information: KIW09920.1

Basic Information

• Species: Exophiala spinifera
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala spinifera
• CAZyme ID: KIW09920.1
• CAZy Family: AA1
• CAZyme Description: Glyco_hydro_2 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D2ATV3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
898		101592.20	5.2309

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EspiniferaCBS89968	12110	N/A	61	12049

• Gene Location: location=KN847501:55900-58596(+)

Full Sequence      

MLRKVIELSSGWRYRAVDESSSSPPTATSIWRTCRSLPTEIHLDLLNDNLIPDPFIGKNE
EALQWVGETKWEYETNLTVPADALVPESRTVLVMEGLDTFATVTLNGKPILQSANAFMTH
RVGLTRDMFETNEGSNLPSSCNDHDESSVTGILRIVFANAEQCGLEIVKQHAEHGWFSLG
SSITRLATRKPQYHYGWDWGPKIMTCGPWRPIYVEYYTSRIADVAISSSLSADLQEAIVE
VSVEVDGLAEHFVMDLLLHGNVVHHEVVPVRERIGRIQMKLATPQLWWPHSLGPATMYSV
QLSLYATQDAEFLIVDQTEKSFGIRKVELVQRGLEDQDGDSFFFKVNNIPIFAAGSCWIP
ADSFLSRISPRRYQDWIQLARDCNQNMIRVWGGGIYENPAFYEACDRQGMLVWQDFMFAC
GSYPVHEEFRRQIVAEAEQNVRRLRHHPCLVLWCGNNEDYVIYPLRGIQYDATETSPEAM
FKSILPARYFYEHVLPTICADLNPGTPYWPGSPFGGAMVNSPLEGDIHQWHVWHFEMFPY
QDFSRLSGRFVSEFGMQALPCLETAKEFFPVEGPCTASETDVLDNQFLKWHNKMADGHDR
LRHYGRANISFGTSALDDVIYNTQLIQAEAVATAYRSWRRLWQGPGKEYCSGALVWQLND
CWPVTSWAIVDYHLRPKMAYWAMKRECAFVTGGLSRITKNGGALALDYWAVNMTQNEVKA
SVTIRAWLVGTGEQVLEQQLHDSVSLQPNRSVDLGILGVDDLKLPTIQQYRDIVFALVVE
LTETEENLPKTVQAVNFHDPLREVPFPSYNAKVDVAISQSAAGISVRARATVPMKGLLFE
VDGDPNAKWDDNGIDLIPGQIAELRYLGQGLRPGQESRLRARWLGGSLDQLSHLRPSL

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	756	1.7e-87	0.6928191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.02e-73	3	685	10	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	7.01e-08	220	325	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	1.23e-04	221	460	211	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
397119	Glyco_hydro_2_C	0.008	377	559	42	247	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO69937.1|GH2	2.13e-237	3	885	4	849
EAA35570.1|GH2	2.66e-236	3	885	4	852
AFJ59925.1|GH2|3.2.1.25	3.88e-236	3	885	4	853
AEO53082.1|GH2	3.51e-234	3	884	4	852
QUC17390.1|GH2	9.29e-234	3	868	4	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.18e-139	4	880	25	824	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.81e-99	4	876	7	826	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.89e-99	4	876	9	828	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.93e-99	4	876	9	828	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.96e-99	4	876	7	826	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	6.90e-237	3	885	4	853	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1CGA8|MANBB_ASPCL	1.18e-196	8	885	9	844	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	9.17e-193	8	885	9	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	1.29e-192	8	885	9	844	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	7.24e-192	8	885	9	844	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIW09920.1.