CAZyme Information: KIW07563.1

Basic Information

• Species: Verruconis gallopava
• Lineage: Ascomycota; Dothideomycetes; ; Sympoventuriaceae; Verruconis; Verruconis gallopava
• CAZyme ID: KIW07563.1
• CAZy Family: GT22
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A0D2ALD2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842	KN847532|CGC8	92638.91	6.2835

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_VgallopavaCBS43764	9871	N/A	53	9818

• Gene Location: location=KN847532:267471-270160(+)

Full Sequence      

MDILPNAEPRETRDDINQLARRLSLREQVLLLSGSDFWRTAEIPHHGIPSIKMTDGPSGA
RGEYFDNGTPAALFTCGISLAATWNTELIQNIGVHLGKETRARGANVLLAPTVNIHRSPL
GGRNFESFSEDPFLTGKIAAAYIRGVQSEGVAATIKHFVANEQETHRMTINSVVDERTLR
EIYLKPFEIAIRESRPWALMSSYNLINGIHADVNEFTLKTILRGEWGFDGAVISDWTALT
EATGVESVRAGCDIEMPGPAKWRGERLIQAVQSGHVSLEDVQNAVKRVLRLIQRTKGLEN
FHYPGELPDDNKALSRAIKKAAVEGIVLLKNDENILPIANARKIAVIGPNAERCVAGGGG
SAKVNPYYLTSPLDGIIAATDAQVLHAKGCDTAKWLPLASGYCRASSGKTGVVIEYYKGD
EFQNDPVSVQYKASTDLYLWDSAPKQVLPDYSFRVRTSLLPKTTGTHTLSFSSVGPGRLL
LNGELFIDNWEWTEEGEAMFGNSMEVRRSIYLKADVPVELLVESTSASRPRSKIDTVGTH
GYGGCRIGYQEEQKTDLVAEAVKLASEADIAILVVGLDNEWESEGYDRKDMELPRDGSQD
RLIEAVLSSNPRTVVVNQSGSPVAMPWADKVPAIVQAWYQGQEAGNALADVLFGKCNPSG
KLPTTFPKRLEDNPSYGNWPGQNLSVVYEEGIFVGYRHYEQHNKAPLFPFGHGLSYTKFL
YSKPQLSSTVLIQECPITVTVPITNVGKLAGHEVVQAYIRARQSAVPRPKKELRAFAKVL
VQPGQTHVVDLKVDKYSVGYYNVNLGSWVAEQGDFEILIGASSSDIRCSATFQVQNSFTW
LF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	41	257	2e-71	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.13e-98	74	841	120	765	beta-glucosidase BglX.
224389	BglX	3.96e-79	36	391	48	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.27e-66	326	696	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.80e-48	6	291	41	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.13e-47	19	794	56	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS68320.1|GH3	0.0	29	827	39	837
QRC98638.1|GH3	0.0	14	842	63	895
CAE7001702.1|GH3	0.0	14	842	67	898
EGX50909.1|GH3	0.0	3	842	7	845
VBB72333.1|GH3	0.0	27	842	92	908

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.07e-194	15	840	5	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.39e-190	15	840	5	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.52e-167	15	839	4	679	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	9.42e-130	14	834	2	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.42e-128	14	834	2	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27034|BGLS_RHIRD	1.09e-227	16	834	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.54e-220	13	841	3	837	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	2.87e-219	13	841	3	837	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q5BFG8|BGLB_EMENI	1.25e-216	16	836	11	842	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.53e-214	15	841	5	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000006

TMHMM  Annotations     

There is no transmembrane helices in KIW07563.1.