CAZyme Information: KIW07350.1

Basic Information

• Species: Verruconis gallopava
• Lineage: Ascomycota; Dothideomycetes; ; Sympoventuriaceae; Verruconis; Verruconis gallopava
• CAZyme ID: KIW07350.1
• CAZy Family: GT2
• CAZyme Description: GPI mannosyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:A0A0D2B7Y9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		43868.35	10.1116

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_VgallopavaCBS43764	9871	N/A	53	9818

• Gene Location: location=KN847533:791947-793379(-)

Full Sequence      

MGLVSLFSSPTFVFGGAVVLRVFLLFWGLYQDATSAFKYTDIDYFVFTDAARFVSQRRSP
YDRDTYRYTPLLAWILVPTAWSRAWFSFGKVLFALADIVAGYLIVVILRSSYRMPRGKAL
GFASIWLLNPMVATISTRGSSEGLLGVLAVALVWAVTQRRIVLAGFILGFSVHFKIYPFI
YAASILWWLDDERRNVASTKGAHRKPTQKSVIQQVLNKDRVLFSCSSLFTFVILNVWMYS
IYGWPFLEHGYLYHLTRVDHRHNFSPYNTMLYLNSSPAAQSSLRLESLAFLPQLMTSAVL
IPLALAKKDLASTMLAQTFAFVTFNKVCTSQAFWLFQGYQLEFLGNSTFVPGLWFASIAF
FLVNCAILSVIISDVALMNDAAKQKKAQ

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	135	333	5.8e-69	0.7175572519083969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.68e-70	17	372	15	415	GPI mannosyltransferase
252941	Mannosyl_trans	1.68e-55	135	372	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	6.59e-07	59	256	49	243	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS69008.1|GT50	1.33e-186	6	381	4	413
QRC91239.1|GT50	2.61e-159	1	374	1	413
CBX94852.1|GT50	4.94e-152	1	374	1	422
QSS62928.1|GT50	3.48e-150	5	387	3	426
QSS74503.1|GT50	4.01e-149	5	387	3	426

PDB Hits     

KIW07350.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	1.38e-143	5	377	3	412	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4I073|GPI14_GIBZE	9.32e-141	7	385	7	418	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	1.23e-138	5	386	3	439	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	1.10e-137	5	375	3	421	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.48e-137	5	374	21	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000001

TMHMM  Annotations     

Start	End
7	29
86	108
140	157
167	189
221	243
289	306
313	335
350	372