CAZyme Information: KIW07024.1

Basic Information

• Species: Verruconis gallopava
• Lineage: Ascomycota; Dothideomycetes; ; Sympoventuriaceae; Verruconis; Verruconis gallopava
• CAZyme ID: KIW07024.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	KN847533|CGC3	57924.32	6.4396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_VgallopavaCBS43764	9871	N/A	53	9818

• Gene Location: location=KN847533:66720-68401(-)

Full Sequence      

MFGRKPYLFAGVLACIAVLLSLSLSKRDHEVAGHGPRGINNTILLLSNYEYGLANVLLAT
SHALLVHHNDIQVHFASFPQRQADALKISKFAREQFPDAGSITFHTIYGPTYGDALNAQG
HFIDQAIHPPGVVGGAQLCRNMQMYLMPWNGSEYLNLYEQVLRIIDDVDPALVVLDPQFG
PAFDATKERRRRHAVISPNSLRDSFAQYQPWGSMFWKYPAMGSGFPYPVPWSLIPANIFM
NLRFIYSVLATPDLAAKKKYLKERGLSNPADFFSVYNDQMTWICQSALEADFPISIVPEN
VKACGPIYLDTAPAAGQDPELASWLAQAPTVLINLGSTTDYDEESAVQMAKAIEILLGAT
NVQVLWKFKRRKYQNYTADFSDDFLGPLKDMLGSRLRLEKWIQIDPAAMMKTGNIIASVH
HGGANCYHEAIGNGIAQVVLPKWVDLYDYATRVEYLGVGVWGNKASAPDWTADELSAAFL
KVVGENDEAVMIRQRAKDLGGLFQGTPGDACAARELARMAKID

Enzyme Prediction     

No EC number prediction in KIW07024.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	114	520	1.5e-18	0.9031413612565445

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	8.70e-21	43	519	3	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	6.28e-08	417	521	303	400	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	6.97e-07	266	460	213	386	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	5.19e-04	297	499	263	442	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52353.1|GT1	8.24e-202	4	521	3	518
CCD43782.2|GT1	1.22e-198	4	521	3	517
APA10835.1|GT1	3.24e-195	1	522	1	525
QSZ37360.1|GT1	2.81e-193	4	522	5	523
CEI41903.1|GT1	1.88e-170	8	520	5	510

PDB Hits     

KIW07024.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1B4XBH6|SDNJ_SORAA	3.60e-79	42	508	7	494	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	9.82e-76	38	481	3	436	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|Q63886|UD11_MOUSE	6.63e-09	228	483	189	433	UDP-glucuronosyltransferase 1A1 OS=Mus musculus OX=10090 GN=Ugt1a1 PE=1 SV=2
sp|A0A0D1DZV5|EMT1_USTMA	2.23e-08	326	522	373	564	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	3.89e-08	337	516	383	559	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.989514	0.010499

TMHMM  Annotations     

Start	End
7	24