CAZyme Information: KIW06516.1

Basic Information

• Species: Verruconis gallopava
• Lineage: Ascomycota; Dothideomycetes; ; Sympoventuriaceae; Verruconis; Verruconis gallopava
• CAZyme ID: KIW06516.1
• CAZy Family: GT1
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0D1XUV5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920		103228.73	5.9439

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_VgallopavaCBS43764	9871	N/A	53	9818

• Gene Location: location=KN847535:845043-848308(-)

Full Sequence      

MAQEERSQEKQSHATSRDDTSQPTTPRIAELEDSNYRISGISTPQSRSNRLTYGDFGEDA
RYGTIVSYLSNRITAQGWFGAKYSTGYESCSGVLVRKTRGQYISIPAIINPMLLSATQKL
NVEVAFTMRTDTVDAILSALEPSQTDILLTDGSQIQILDSLEEVMTTNVKKLQYAALLRR
EEILLIWHDDLQKILPHAAMMEEKLLSLVWGSTISPFANPFDTPLPSNVGSRAPSFYHHP
IEALSSKLPANTIDPSKEGEPFGDEEDEKHAVEAESLDRPISFVSAIFVGMGMCLAVVLL
FGFATGNLLIECLLDGKWIRLVFVVTIPLLLLVGLFFLITIFTNLFEMFGPIDGAKGNSR
SFSGKKPSLRKAYQNGFRPPHITIQMPVYKEGLEGVIKPTVDSLKAAISYYESRGVGTAS
IFINDDGMRAGISEDEARARREYYHDNNIGWVARPKHNDEDGYVRKGKFKKASNMNFALN
VANKVEEYLQQMIEERVAAGMSDYLSDVELDEMYKANLERVLRENPRVMAAGNIRMGEII
LIIDSDTRVPVDCLLYGAAEMFLSPEVAIVQHSTGVMQVQHDYFENGITYFTNMVYSAIN
FSVSNGEVAPFVGHNAFLRWQAVQSVGKEDPDGYIAYWSESHVSEDFDLALRLQIKGNVV
RCAHYHNNEFKEGVSLTIYDELARWEKYAYGCSELVFHPFKYWLFRGPLTPLFRQFLWSN
LILSSKITILGYISSYFALAAGATLTLMNYLLIGWFNGGLDKFYMESWKIFVSLIVVFNI
LGPVALAILRYRLGEKSLIASLLENFKWMPMFSIFFGGLSFHLTCAILSHLCSIDMQWGA
TTKESQKSNFFKELPKIFKSFKYMYCVLIVIIGGMIYLGCFAPSGWDIKGATAVVPLAVS
VTSHAILPFALNPSVMIFNF

Enzyme Prediction     

No EC number prediction in KIW06516.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	539	752	6.2e-56	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	3.44e-54	539	756	1	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	7.78e-12	384	646	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.09e-11	537	815	138	403	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133043	CESA_CelA_like	9.08e-05	380	657	1	197	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
184755	hmsR	3.97e-04	476	656	85	266	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI18966.1|GT0	0.0	25	920	23	905
CAC28725.2|GT0	0.0	39	920	132	1003
QLI74022.1|GT0	0.0	33	920	25	902
QGA18667.1|GT0	0.0	25	920	16	919
QUC19563.1|GT0	0.0	56	920	49	911

PDB Hits     

KIW06516.1 has no PDB hit.

Swiss-Prot Hits     

KIW06516.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999883	0.000155

TMHMM  Annotations     

Start	End
287	309
321	343
736	758
770	792
812	834
864	886
896	918