CAZyme Information: KIW06242.1

Basic Information

• Species: Verruconis gallopava
• Lineage: Ascomycota; Dothideomycetes; ; Sympoventuriaceae; Verruconis; Verruconis gallopava
• CAZyme ID: KIW06242.1
• CAZy Family: GH79
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	KN847535|CGC6	37332.57	7.9077

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_VgallopavaCBS43764	9871	N/A	53	9818

• Gene Location: location=KN847535:212011-213119(-)

Full Sequence      

MHYAYPGRKSSHPTSFTPRQSRSSILHTIRRRVRLRTLLTAALALGLLYLVLSWLFSSSS
TEISSIPVAPVFTKAPSGEPNVVIVTVLDDEKGQVYNTAVKQNRQEYAEKHGYATFMPQA
TEYNVGDSPKSWAKVPALRHAMTVFPRTPFFLFLDDRTLIANPSLSVEEHLTNKQRIESL
AITDIPVVPPDSVIRTTRDQPGDLVDLLLVQDREGLSVRSFVLRNGDWAKFFLDAWFDPL
YRTYNFQKAERHALEHIVQWHGTILAKLALVPQHMLCAYSEKDKRAATDNGVYENGNFVI
SFAECDSPDRSCRDEMKPWFERLHGLEI

Enzyme Prediction     

No EC number prediction in KIW06242.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	80	313	1e-64	0.983739837398374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.03e-64	78	305	1	232	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS73831.1|GT34	1.19e-129	1	325	1	320
QSZ33097.1|GT34	1.19e-100	1	319	1	297
QRC94257.1|GT34	1.11e-99	1	323	1	320
APA16197.1|GT34	1.85e-97	1	319	1	298
ATZ57222.1|GT34	6.89e-95	1	319	1	298

PDB Hits     

KIW06242.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	8.97e-31	91	307	83	295	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	2.73e-28	96	305	123	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	5.86e-24	99	306	126	334	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|P46985|MNN11_YEAST	1.45e-21	80	323	158	419	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|Q10359|GMH3_SCHPO	2.50e-20	94	324	106	332	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999994	0.000028

TMHMM  Annotations     

Start	End
35	57