CAZyme Information: KIW06112.1

Basic Information

• Species: Verruconis gallopava
• Lineage: Ascomycota; Dothideomycetes; ; Sympoventuriaceae; Verruconis; Verruconis gallopava
• CAZyme ID: KIW06112.1
• CAZy Family: GH76
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A0D1YZI5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572	KN847536|CGC1	64762.85	7.5533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_VgallopavaCBS43764	9871	N/A	53	9818

• Gene Location: location=KN847536:823595-825313(+)

Full Sequence      

MRPLSRSRDPVTTAKLISASIVIIFYLLYVAFHKPVVVAPKYPKRVRQWIQQEKWVNSTG
EADVERRDAVKKAMRHTFEGYRKRAWGNDEILPVTGGVGNTRNGWGATIVDASTTLALMG
MWDELTLCVDYIIDEIDFSSSFALVDPFETTIRYLGGLVSLIQLVDEKVIPEKVINSAKR
KKLLAKTEMLAKNLLPAYSTPTGMPWPRVDFSKRSGVPDPPEVYEKDPSKPRYINPAIGP
ARAGSNILENCVLSELTGNWEYCAKSTLAWFPLVYSKWIVDAPGLVDAPIDIITGEPVGR
QKHWDAGHDSYYEYLIKAALLRPHSPNSKMYSQRWLEAADALRHNLSSRASPSLDHPVSH
LYMGKLNGPWFLNEQSHLACFAPGNLLLGARHLNRKDLLVLGQALLEGCRHSYSATPTGI
GPESWSWIPAPPYRNGTFAPETERQLSEHADYGFWTVNPKYKLRPEYVESLFYAYRITGE
QRYREWAWEAFQAIEKHCKTEYGYAGLQDVMLLPKTKGAGGEKDHSGWLDESESFWAAET
LKYLWLIFADVSVGSLDDWVYSTEGHLFRRPS

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	73	570	1.9e-117	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	3.96e-165	73	570	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	4.37e-105	61	571	67	519	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS69807.1|GH47	3.37e-287	8	571	27	644
CBX90682.1|GH47	8.26e-211	8	569	14	566
CAE7174864.1|GH47	1.91e-209	8	569	14	566
QRD07001.1|GH47	4.41e-205	8	569	14	564
EGX51673.1|GH47	3.92e-132	48	563	45	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	5.26e-79	68	566	7	469	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	9.64e-79	51	566	25	504	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	7.05e-68	60	572	9	494	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	4.25e-55	65	568	21	465	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	5.17e-55	65	568	19	463	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12563|MNS1B_ASPPH	1.26e-84	56	572	32	512	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|A1CP08|MNS1B_ASPCL	3.30e-84	69	569	38	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q0D076|MNS1B_ASPTN	4.28e-84	66	569	39	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	1.03e-82	56	572	32	512	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q5BF93|MNS1B_EMENI	1.17e-82	66	569	33	500	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mns1B PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000003

TMHMM  Annotations     

Start	End
13	32