CAZyme Information: KIW05918.1

Basic Information

• Species: Verruconis gallopava
• Lineage: Ascomycota; Dothideomycetes; ; Sympoventuriaceae; Verruconis; Verruconis gallopava
• CAZyme ID: KIW05918.1
• CAZy Family: GH76
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A0D2AG24]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846		93435.94	6.1245

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_VgallopavaCBS43764	9871	N/A	53	9818

• Gene Location: location=KN847536:312553-315147(-)

Full Sequence      

MHKSNFPLTPPSPYDPFNVEETLIRLTEKEKIDLLTGIDHWHTAGVPRLGVPSIRVSDGP
NGVRGTRFFNGQRAACLPCGTALGATWDTELLQRAGDLLGEETKAKGAHVLLGPTVNMQR
SPLGGRGFESFSEDPILAGSCAASVVRGIQKTGTAACIKHFVANDQEHERMAVSAIVTDR
ALREIYLLPFQITIRESAPRALMTAYNKINGTHASERREYIQHILREEWGWEGLVMSDWY
GTYSTAEAINAGLDLEMPGPSRWRGQLLSHALLSKKVTRHTLDQRVREVLRFVTQAAKTG
IPENAPERARNVPETAELLRKLSADSMVLLKNEHDVLPLDKAKSVAAIGPNTKNPAFCGG
GSASLQPYYVVSPFEGMMRKAQDVQYAVGCAAYKLLPLLGPHLRTKDGNPGVTFKAYASP
PTEAGSEPVEILNVLDTYIYLSDYSHPRLVQDLWWAEVEGYFTAEETGDFQFGLTVYGTG
KLYIDDELVVDNEAKQRSGGSFFNVGTVEEIGIKRVYQGMTYKLKVSFASGVTSKLANPD
GVVSFGGGGIRIGGAKILDPEEEIRKAVQLAKSVDQAVLFVGLNSDYEQEGHDRQHMHLP
GLTDRLVQEVAAANPRTVVVVQSGTPVSMPWASSVAGIIQAWYGGNETGNAIADVLYGDI
NPSGKLPLSFPVRIEDNPAYLNFSSERGRVLYGEDIFIGYRWYEATKREPLWSFGWGLSY
TSFRFYDLLVLNDRQSSQLVVKVWLENTGKIDGAEVVQVYVSQRSPSVRRPCKELKGFAK
KFLKAGEAAMVEIVMDRKYATSFWDEERNMWIEEADTFDVLVGNSSAETPLRGSFSIEKT
SWWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	44	258	3.8e-68	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	9.12e-71	41	355	50	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.14e-70	71	829	115	757	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.10e-54	327	700	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	3.76e-45	6	807	30	754	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.11e-37	48	291	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55191.1|GH3	0.0	18	846	21	851
UPK92097.1|GH3	0.0	17	846	15	846
UQC79070.1|GH3|GH78	0.0	17	842	38	865
CCD50485.1|GH3	0.0	17	846	5	833
ATZ56815.1|GH3	0.0	17	846	5	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.23e-267	17	846	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.43e-261	17	846	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.75e-147	18	840	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.39e-119	26	828	12	654	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	9.30e-110	19	837	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	18	846	5	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	18	846	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	0.0	18	846	5	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|A1CA51|BGLI_ASPCL	0.0	17	846	4	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	18	846	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KIW05918.1.