CAZyme Information: KIW04779.1

Basic Information

• Species: Verruconis gallopava
• Lineage: Ascomycota; Dothideomycetes; ; Sympoventuriaceae; Verruconis; Verruconis gallopava
• CAZyme ID: KIW04779.1
• CAZy Family: GH43|CBM91
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	KN847539|CGC3	85886.02	4.4763

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_VgallopavaCBS43764	9871	N/A	53	9818

• Gene Location: location=KN847539:85192-87756(+)

Full Sequence      

MMLSRLALVATLPLFSSVSIAAPTAAAQPLDASGFIAQASGSTQYWLSNIQRQGTVAFGD
ASYKIFRNVKTDCGAAGDGSTDDTAALNQCIASGNRCGPNCDSSTVTPAILYFPPGTYVV
SQPLNMYYYTQMIGDALQPPTIKAAANFQGMAVLDSDPYDYNNGGKNWFTNQNNFFREVR
NFVIDLTAMPASQGAGIHWQVAQATSLQNIRFEMVQGTNSNQIGIFMDNGSGGFMADLTF
NGGNYGMFLGNQQFTTRNLTFNNCNTAMFMNWNWLWTFKSVNVNNCKVGLDMANNPPNQT
VGSVILQDSVFKTTVAAVNSSFSQSSIPTGGGTLVLDNVDFTGSPVAVQHFDGTPILQGG
SVVKAWTQGQQYVGSNGTRVQAVLESPPAKPDALLANGMIFERIKPQYEQYPASAFVSVK
SAGAKGDGATDDTAAIQNAMNNIQDGQILYFDHGAYIVTKTINVPKNIKITGEIWPLIMA
SGDFFANQDQPQPVFKIGDIGDVGSVELSELMFETAGPAPGAIMIQWNSGASAQGSNGMW
DVHARIGGSAGTQLQWDKCAKNPNVTHGANPECIGANTLLHLTQTSSVYIENCWFWVADH
ELDLPAKPAQIDIYNGRGVLIESQGPVWMYGTASEHSVLYNYQVQNASNIYMGLIQTESP
YFQSNPAAPAPFNLVANVDPPFNTYTSDQDKKAWGLRVVDSSNILVYGAGLYSFFDNYDQ
VCVASNNCQNRIVSIEGNVDNLNLFGLSTKASVSMVSSVGGYVLSGSANNGNAMTVDSVT
VNDADNRSNFCATLALWRPG

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	39	772	3.3e-295	0.9743243243243244

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.59e-88	66	291	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	3.96e-11	416	484	1	74	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
314993	End_N_terminal	4.30e-04	424	485	1	67	N terminal extension of bacteriophage endosialidase. This domain family is found in bacteria and viruses, and is approximately 70 amino acids in length. This domain is found in the bacteriophage protein endosialidase. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain. The endosialidase protein complexes to form homotrimeric molecules.
227721	Pgu1	0.006	388	456	52	124	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS77507.1|GH55	0.0	33	799	32	790
CAF32160.1|GH55	8.12e-310	28	797	29	944
ACS66685.1|GH55|3.2.1.58	5.06e-308	45	798	34	782
QMW47168.1|GH55	1.67e-307	39	798	43	948
QRD91479.1|GH55	1.67e-307	39	798	43	948

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	6.45e-310	45	798	6	754	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	8.77e-209	45	740	26	716	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	2.72e-07	417	472	75	139	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	2.47e-299	42	800	40	876	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	1.11e-193	45	760	48	764	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	2.29e-56	59	753	57	729	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000277	0.999719	CS pos: 27-28. Pr: 0.8928

TMHMM  Annotations     

There is no transmembrane helices in KIW04779.1.