CAZyme Information: KIW00212.1

Basic Information

• Species: Verruconis gallopava
• Lineage: Ascomycota; Dothideomycetes; ; Sympoventuriaceae; Verruconis; Verruconis gallopava
• CAZyme ID: KIW00212.1
• CAZy Family: AA9
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A0D1YHA2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834		91590.90	5.3845

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_VgallopavaCBS43764	9871	N/A	53	9818

• Gene Location: location=KN847566:141421-144065(-)

Full Sequence      

MHCQQQRVTRPTPSRLTITQVVHSSLETTGIPSAPPFPTTSLVFPTTKLNITSLSTYSSL
PTILPPTSESSGQVNKINILTVPIATYPPPGQIAPRSDYPRPPVGVRARSGPLQTNKFYE
NLLLDDQRQSIWPQPYSLTWAKGGDADRGGLANSWGLSVSNIDRQGLLYGDPIQSGEPPK
FFTAPLYVESIILSASELDTNTVLTTDSHDQFSLDINLTPKPDGQPVIRFPVVQGMGFVS
ALYTNATPLLQSSVFFTDLIEIGDVDSGKTHKWRIQLKDGTSWLLYITPDGSFGRPSMVL
KDSNTIIGPGSFTGLIQVAKNTAGSCGERVYDGSAGTYATSLAVSASVDGATGNYSFIWR
RAGSSDQQLLMFALPHHIDTMSPDTLNQSTCVTLWTTTKGEARGLQADMWLLQEQNLPTD
IDFDPWKPGSGAVKKAVDEATAQIDDAAATELALDIDKLTNLDSAYYGGKALSKFALIIY
AVNKFGKSSSLALEGLRKLEAAFDRWISNKQVWPFAYDSLWGGIVSTASYEDRDIGADFG
NTLYNDHHFHYGYFVHTAAVIAALDPDWLKRGSNKVWVDTLIRDYANPDAGDPYFPPSRS
FDFFNGHSWATGLFPSGDGKNEESSSEDAFSIYAMKLWGKVTGDSAMEARGNLQLAILRR
SLNHYFYFDANNTAQPPRFTPQITSGILFENKIDHTTFFGQNSEYVEGIHMLPISPVTPY
MRPDSFVSREWSAYFQSPYPLSSVPDAETTVLLPAVGYAGGYNCSSRINLRRLINCVDPA
WKGILMANLAQLDPKQSWQFFADKLGAGWDWMWVAGSGSRTWYLAYAAALGGTR

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	100	737	1.9e-190	0.905144694533762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	30	832	11	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	438	824	4	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	3.07e-119	100	428	2	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS75982.1|GH81	3.47e-268	22	832	69	831
AAF13033.2|GH81|3.2.1.39	8.42e-226	112	828	44	721
UDD56325.1|GH81	1.52e-225	82	832	12	723
BAE58039.1|GH81	2.94e-223	82	828	12	719
ABX90783.1|GH81	2.94e-223	82	828	12	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.50e-84	80	731	8	662	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.70e-84	80	731	33	687	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.70e-81	80	731	8	662	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.18e-30	451	724	326	591	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	5.58e-26	466	731	361	623	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	2.75e-197	83	828	196	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	6.89e-163	82	833	5	705	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.88e-146	99	830	66	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	2.51e-142	70	829	66	777	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.15e-134	84	828	432	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIW00212.1.