CAZyme Information: KIW00152.1

Basic Information

• Species: Verruconis gallopava
• Lineage: Ascomycota; Dothideomycetes; ; Sympoventuriaceae; Verruconis; Verruconis gallopava
• CAZyme ID: KIW00152.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657		73726.12	6.3483

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_VgallopavaCBS43764	9871	N/A	53	9818

• Gene Location: location=KN847567:176802-179486(+)

Full Sequence      

MRHATALLCRSCLLVYLAVSATLSVLPDKMLLFTVLAFAAEAIAFGRTEHQVVLGGHTGK
YSVQTPPLDTDWTYQVGTEPWPQYPRPKLARSQWQTLNGLWTYANASGHSALKHPPFNRT
LPQEVLVPFCLESGLSGIQGENTIYSWYRTTFTVPSTWTGDRVLLNFGAVDYEATVFVNG
HNVTFHRGGYTGFSVDVTDYLISGHNELIVFAFDPTDHHDYVIPVGKQTLRPSHIFYRPC
SGIWQSVWIESAPKNYISQLTINGDASGNLNLSVSVTGSKHSSVEVAVFERGTHIPLATH
KATAASPISFKVKSVKTWSPNIPNLYDVIITMGQDIVHSYTGFRTIESKNVHGVQRISLN
GDIIFPFGTLDQGYWPDGLYTPPTYEAMTYDLKMLKYLGYNMLRKHIKVEPPLYYAAADE
LGILIMQDMPSLALTRLPNKDQQAEFERQVDVIVSQLSSYSSIFAWVIYNEGWGQITSHH
PEFDIAEAIYAQDPTRLVNAVSGWHDHGAGDFSDNHHYTFPRCGTPEYYSSTTVFDPSRI
GFQGEFGGPGHNVSAEHLWKVKQAIDAIDHTYELYDTIDAWNFRSHFIMTELLYQTQLYS
CAGAVWTQTTDVEGEVNGMMTYDRRILRPDVIRWRADIQAVYDASALRANGSIPRAS

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	89	545	4.2e-96	0.5172872340425532

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.72e-37	92	499	10	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	1.05e-31	147	502	68	449	beta-D-glucuronidase; Provisional
236673	ebgA	5.25e-17	148	512	113	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	8.84e-17	68	253	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
395572	Glyco_hydro_2	3.19e-10	256	344	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX62483.1|GH2	0.0	80	656	453	1019
SMY28175.1|GH2	2.52e-307	60	654	30	636
SMR62806.1|GH2	2.06e-306	60	654	30	636
SMR58957.1|GH2	1.68e-305	60	654	30	636
QKX54330.1|GH2	2.78e-282	55	653	21	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.88e-109	68	630	12	571	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	7.60e-25	96	498	22	450	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
6U7I_A	9.49e-25	84	498	3	446	Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_B Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_C Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_D Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii]
5C71_A	1.95e-24	96	498	47	475	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
7VQM_A	5.42e-24	147	471	97	409	Chain A, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_B Chain B, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_C Chain C, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_D Chain D, GH2 beta-galacturonate AqGalA [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	1.19e-24	146	471	105	430	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|T2KM09|PLH16_FORAG	8.37e-21	137	503	94	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|P77989|BGAL_THEP3	2.21e-18	146	430	58	348	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|P05804|BGLR_ECOLI	8.58e-17	97	502	15	445	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
sp|P24131|BGAL_CLOAT	1.38e-14	95	499	47	483	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.515762	0.484228

TMHMM  Annotations     

Start	End
7	26