CAZyme Information: KIS71499.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS71499.1
• CAZy Family: GT22
• CAZyme Description: putative beta-1,3 exoglucanase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		84762.65	4.2964

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003141:1739354-1741699(-)

Full Sequence      

MQAGQSVDASQATPVAFNGTFWLELINHNGTATYNPDPSSYRVFRNVKDFGAKGDGTTDD
TEAINLAISQGGRCGQGCGSSTVSPAVVYFPPGKYLVSSPITSYYYTQLVGSATDRPTLL
AAPSFQGIAVIDEDPYASDGSNWYINQNNFFRAVYNFKIDLTQMPPSSGTGIHHQVSQAT
SLFNVHFEMRQDADNGQQGVFIENGSGGFMTDLTFRGGRYGAYLGNQQFTVRNSSFENCQ
TAISQAWNWGWSYHDIRIVNCTLGLEMRTSADPASGSQGAASILAYDWSLDSVETAFNIT
TPGSGTLILDNISIDKVGTVVLAGQDSVLLVGSDTPSVVASWVQGATVDGKQPLENVQSV
STVNIARPATLVKTEEPSRPWFSRSRPQYEWAGPSDIVNVKQLGCAGDGTTDDSQALQQI
LNENAGQKIVYVPQGTYYLESTVTFPPGTRVVGEVWPVLIGGGPLFQNASAPQPVVRIGN
PGDSGVMEISDMIFSTRGPAPGAIVVEWNIREHEGTQGSAAIWDSHIRVGGFAGTNLEAD
KCAREQPLSDDCRASFLNLHLTPNSSAYMENTWVWTADHDLDYAERTQVNLLSGRGVLIE
SAQGPVWMYGGASEHSVLYQYNIVNANNVFISLAQTETAYFQGNGRAVASAEEPLSIELY
HDPNFNLSSAQCTASPFQDPSDPYENRGFGMRIANSTNVFVYGAGLYSFFDNYDQSQVSA
RRSQKRILWLQDVQDDANVWILNLNTVGVEQMVTVDGQDVVDEQPLRNGFGNTLAVWTTQ
L

Enzyme Prediction     

EC	3.2.1.58:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	14	777	1.3e-255	0.9878378378378379

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.07e-90	44	266	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.32e-07	397	463	1	72	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
215426	PLN02793	0.003	38	142	47	132	Probable polygalacturonase
227721	Pgu1	0.006	397	445	82	137	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDI52287.1|GH55	0.0	1	781	200	982
SJX61477.1|GH55	0.0	6	781	5	780
CBQ70801.1|GH55	0.0	6	781	5	780
SAM78612.1|GH55	0.0	1	779	1	779
CDR88106.1|GH55	0.0	164	781	1	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	8.21e-237	21	775	6	751	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	4.80e-228	21	778	26	756	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	3.16e-06	46	215	76	255	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	1.67e-211	3	777	25	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	6.35e-172	6	759	34	766	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.36e-52	60	730	71	711	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KIS71499.1.