CAZyme Information: KIS70799.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS70799.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	CM003142|CGC1	43847.86	5.5012

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003142:1403853-1405028(+)

Full Sequence      

MTTDSPSFSLSPAQAASLVDKLIHKLLHNEDRDGKFLLALDDGRIIDTKGWAGWEWTHGV
ALYALFEHHRLTNSTTSLDIIAQWFRDRFAEGGTTKNINTMAALLSLAFVYELDPSSQPE
NRTHLIEWAEWAMNELPKTSEGGFQHITYDSENKGQLWDDTLMMTVLPLAKIGKVLGIER
YVQEAKYQFLLHVKYLYDAKSGLWFHGWTFEGRHHFAGAHWARGNCWITLAIPLLFHILG
DEDVDLIDRTSFFARHLVGTLEAQVDALLPLQDEKTGLWHTLLKYDDSYVESSATAGFAA
GAYLALRFGLIKDHNKKKAYEAMADKALKGVVSMIAEDGQLQQTSFGTAMGHDLDFYRNI
AITPMPYGQALALLAIVEKMALADVTAPDEA

Enzyme Prediction     

No EC number prediction in KIS70799.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	50	378	3.3e-94	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	7.19e-89	19	381	1	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.31e-83	33	378	6	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX62056.1|GH105	9.95e-238	1	382	1	382
CBQ72185.1|GH105	1.65e-236	1	382	1	382
CDS82403.1|GH105	3.42e-233	1	382	1	380
SAM81338.1|GH105	9.45e-233	1	386	1	385
CDI52814.1|GH105	9.45e-224	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	2.89e-131	6	380	17	377	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.26e-130	8	378	1	367	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	2.09e-126	6	380	18	378	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	2.57e-13	130	357	175	387	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	8.31e-10	54	322	23	294	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	4.15e-40	54	380	29	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KIS70799.1.