CAZyme Information: KIS70716.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS70716.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	CM003142|CGC8	67630.54	7.1902

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003142:1219065-1220954(+)

Full Sequence      

MGLFSSPTLLSDASAYATAANLAPQTVEEAQKAKSYDFIICGAGTAGCVLASRLSENPNT
SVLVLEAGGNNDALEVKAPLVFTKNFKTERDWDYTTTPQASVLNKEMQWPRGKLIGGSSS
INAMMYHHCAPSDYDEWSEKYNCKGWSYKEFLPFLNRAEKYTPHASQPDVKVEERGSSGP
WKTGHSSYKSEVTSKGFVNACVEVGIPFNPDLNTHRGSEGVTQFTTFIDSSGRRSSAATA
YLPLEVQKRPNLTIGIHVMVNRVIFDRTGSRPKAIAVELQNSKGGKKYYAAAKQRIVICG
GAINSPQTLMLSGVGPAATLNKHGIPVVVDNALVGQRLSDHLCHSTINVKAKPGHTLDYL
GSDIKAIPSLARWLVTGGGPVSSNAGEAAAFVRCNDQSLPLVNSLTKPENRPQYFGSLGK
GPDIELICTPLAYVDHGATTAPAGTGCVSIVGLNVRPRSKGTISIKSADPWEKAIVDPKY
FTDPDDNDRKVTLAGVRLAIAIAKANALQPYLEDYQSDNEDDFWWPVSSTDPDKLTDDQL
MKFICKRAFTLYHPVGTAKMGPDASDSVVDTALHVHGVDRLVVCDASIFPEQISGHPTAA
IIAVAEKAAELLKHIAADKAASSTIPSHL

Enzyme Prediction     

No EC number prediction in KIS70716.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	34	613	5.1e-169	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.24e-135	31	611	1	530	choline dehydrogenase; Validated
225186	BetA	1.41e-125	33	623	5	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.65e-45	457	608	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.28e-38	100	343	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.58e-37	35	602	55	566	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS82315.1|AA3_2	0.0	1	629	1	629
CBQ72101.1|AA3_2	0.0	1	622	1	622
SJX61973.1|AA3_2	0.0	1	622	1	622
CDI52744.1|AA3_2	0.0	1	629	1	629
ULM60689.1|AA3_2	1.51e-272	1	622	1	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	1.56e-75	33	625	5	576	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	4.23e-75	34	625	6	576	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	4.23e-75	34	625	6	576	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	5.91e-75	34	625	6	576	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	6.10e-75	34	625	22	592	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A3B1EFP9|STR4_STRTC	4.66e-127	29	616	29	615	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|P64264|Y1310_MYCBO	5.45e-90	37	613	6	527	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	5.45e-90	37	613	6	527	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	5.45e-90	37	613	6	527	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	9.59e-82	33	612	4	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000003

TMHMM  Annotations     

There is no transmembrane helices in KIS70716.1.