CAZyme Information: KIS69681.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS69681.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798	CM003144|CGC5	86267.99	4.2961

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003144:521163-523559(-)

Full Sequence      

MRFAAFTSLAALVPALTLVAAQDGSAISATSVVSGVASSASVTGAASSVTSAASSTITSA
SGTGTSDSAASSASVNPLTEKPPAAVPSATGSPTGFIPTGALPPSQDLCSSPIYCPGPLL
QAVQLAGIFEDSKTFVDKPTSKPESEVVDNFNRLGGGNTSNITYQEIVQFVQDNFVAEGV
ELVPADLGDEFVEDPEFLTRVEDEVVRDWLKQVHSYWELLARTTNSSSPSGAQCDGCVSS
FIPFNESRVFVIPGGRFRELYYWDTFFVIEGLITSQLQSVVKAILENFGDLIDRLGFIPN
GNRIYYENRSQPPFFALMVDKYIEAYNDTSVLERFLPLLEREMWFWKNNRTIEFTSPFTN
NTHNVTHYKVDTSAPRPESYLEDYKTVQDAGESGLELNDTQKATLYSNIAAGAESGSDYS
AARWSSRPTINLSDTIPAQRFLETAAQLPVDLNAILFACEQKLSAFYKISSNQTQVNATR
ANYWAQQAQARKEAILDLFWDPSKRFFYDFNTTLGDRAPFFTPAGFFPLWAKILPQEFVN
ESISIDQRRQNLQGVFSGLRYIIDRFNGTLPASLVTTGQQWDFANAWPPHTYIALEALRN
VPDILGAGAQLAAENGSFALIPMHNGTNQLGQTQDSLPVQGLENQPGSAINETLAGATDP
NNAAVELKPALNTGNTTSGESWRDELVRELANRYVASALCSWRATGGKLNTTDPAFQPVA
DDVLTANGLNASTAIGNMFEKFNASDINAAGSGGEYVVQTGFGWTNGVAIWLGGQLGANL
TRPDCPPVIAQNTTPAEA

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	128	609	1.6e-116	0.8716904276985743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.63e-120	128	770	2	502	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	3.22e-98	114	785	13	554	alpha,alpha-trehalase
224541	TreA	5.10e-71	102	600	46	485	Neutral trehalase [Carbohydrate transport and metabolism].
183934	treF	2.26e-58	102	600	47	479	alpha,alpha-trehalase TreF.
183936	treA	1.83e-57	84	599	26	469	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ72773.1|GH37	0.0	1	797	1	791
SJX62605.1|GH37	0.0	1	797	1	797
CDU25958.1|GH37	0.0	78	797	88	807
SAM83085.1|GH37	0.0	72	797	30	755
BCI56844.1|GH37	1.33e-186	86	789	38	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z66_A	9.64e-50	110	600	45	473	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
7E9U_A	2.13e-47	131	770	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	7.34e-47	117	600	15	436	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
7E9X_A	2.47e-46	131	770	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JF4_A	1.84e-44	117	600	15	436	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	6.52e-101	109	785	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|P32359|TREA_TENMO	4.28e-87	105	770	21	546	Trehalase OS=Tenebrio molitor OX=7067 PE=2 SV=1
sp|Q8MMG9|TREA_PIMHY	6.67e-87	90	768	26	563	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|P19813|TREA_RABIT	1.17e-83	101	603	23	484	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|A8J4S9|TREA_APIME	5.26e-83	109	784	41	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999703	CS pos: 21-22. Pr: 0.9595

TMHMM  Annotations     

There is no transmembrane helices in KIS69681.1.