CAZyme Information: KIS69473.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS69473.1
• CAZy Family: GH45
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1155	CM003145|CGC7	127707.54	6.6852

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003145:977141-980608(+)

Full Sequence      

MTDAATATTARNARSRSTSASLKTSRYSLPRSKSGSTSLPSSPTTGKRGLTFDVTTDKSS
ATTAVIDEATALGDASMSKEVSTDGANWIDAREGYRLMAMHLWQAFRRECLFGLDPACSG
MEAASGVAIRYGKGQYVVCPSNDQRLVDFCQSVAVLNCEAAMTLTSSVVAAITTRLVGSI
THVPITPCQHIQVVDTMSALAGARKAQNACFVRSEQTLVVWSDKVESLQDSAKDLEEKMI
RFVWNSSYYSNANNLVVASSTSGSCTPALAWPTSSTPSSMPDSGATSPISPTFSSKTSIS
SLANQDHLDKSARNHRPSYQKELDALGRQGSFQSIDGLAVSAAKERAVSGDIASLSTSPK
CALLRKASIAADRKVSFTDPAPDPIGIPNEDQRTSNVETPGSSGKVEALVRQAGLQRNNS
TFSETNTSQLSSSRSSLSLANEKRQNDSETGESIRDDSDREKQHDEYEQRPLSYIAPLQH
GLAVALDILICFLFISKLFEHALRDGDWRRMALAPITLVMFPVILFFCDNIIGIIMQLVG
PVNQLHQNSLYFSGKPPVRKLTADLPHITIQMPVYKESLHGVLMPTIESVKKAITTYELQ
GGTAGIVVSEDGMLLMDKQEQNIRKQFYERNNVGWVARPAHGQEGYLRKGRFKKASNLNF
TCHLSMAVEEMMSKARPTTLAELERFHSDPEFVASTEESARVSGEQVASIENKEQVDQQA
QSQSQSQSQRLGSDDWSDADETELYRQCLEACLARMHRLAQAKGNIRIGQLILMIDSDTR
VPQDCLLDAATEMTQCPDVGVLQHCSGVMLVSDSYFETCIAFFTRLVNFAISFTVANGDV
APFIGHNAILRWSAMQEASFIDPDDQVRKIWSESHVSEDFDMALRLLMAGYITRWATYSN
NGFEEGVSLTCDDELNRWQKYAFGCSELVLHRIWHWPFKGLFTPLFKTFLKSSAPIHYKF
SACSYIFSYYAIGAAFPMTFGLYLVEGWFYPVLDPSFMTPFKIWVSVVVVFTLGGNVGQI
AARYRAKQASLLHLIKEHLSWMPCMFVFFGGLSYHVATALLSHPLGIDMSWGATNKDLAD
SNFFLEVPLIWKRFCKVILLCTLSIVLVVIMQIPAIVPLNWSIQGFYTYWPLLLTAISHL
IYPIVLNPALLRFSF

Enzyme Prediction     

No EC number prediction in KIS69473.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	772	982	1.1e-54	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.21e-53	771	984	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	2.42e-10	769	1057	138	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	8.31e-06	769	879	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133034	Glucan_BSP_MdoH	9.90e-06	773	924	100	250	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
225494	MdoH	4.09e-05	755	936	219	410	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDI56973.1|GT0	0.0	11	1155	74	1230
SJX66441.1|GT0	0.0	98	1155	1	1072
CDU25172.1|GT0	0.0	98	1155	1	879
SJX63886.1|GT0	0.0	98	1155	1	878
CBQ68257.1|GT0	0.0	98	1155	1	878

PDB Hits     

KIS69473.1 has no PDB hit.

Swiss-Prot Hits     

KIS69473.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

Start	End
477	499
512	534
968	990
1003	1025
1045	1067
1097	1119
1129	1151