CAZyme Information: KIS69152.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS69152.1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1032		114637.47	6.5527

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003146:946511-949607(+)

Full Sequence      

MSHPPAVKDNQQHQGSTHNSVATDNPASEVMVASLASWSPKNSASAAALPNQEACLHTAD
SIGHSGSPIMDVSPAMPSMPFTPPMSSSPKAQDATIRMMLAHMYRTGQREEWLHDDGADY
EQEGVFMLCPTALHGIYAHPAEAESEIEWVKELLVSVQASCAVIAKPASTYELLKHVSLH
PSLILETGEEIPIVDDLSQVSMLASTSGCLLLRSTGMAVSYGSAIDVLHMARQLDAALVT
SLFAFTMPALPSSIHMAATVAQEEQQHDDEVRAVMHQQPNAQQREWLSSLPPSDKPDKQA
SSDDSMLSGEKEITEKSVAPVVLFDQETGETVLEPERTSTHVAALLSGLGVAVNMVIMSL
FARDVVINTLADSNYMRAVLLVAIVPRFLVAQYFCDHIILILAQLIFPVSQMHRNSLYYS
GAPSAPLAKDHRLPHFTVHMPCYKEGLQTVLAPSLKSVMDAVHAYRAQGGTANVVISEDG
LRLLGKQEAEERVRFYNAMGCSWVARPADGEKGYKRLGRFKKASNLNFTYTLSLRLEQII
DEISTTRRQQRIAAQSSNASANFSETGAEIEAEDQAIYAEALQRVLDESDGRAWATGNIR
MGDYILLIDSDTRVPENCLMQAAAELERSPDVGALQHCSGITYVQHHYFERLLGYFVGVF
TNFSISWVCSNGAMAPLMGHNVFLRWTALQQVADKRLLQEERQIFSSQHVSEDYELAMRL
QMAGYCVRWATYSNQAFREGVSLNPTDEKARWQKYAFGACEILFNPFVRWYKGPFTSLFW
RFMWSRNVRTAGKLSMLSYLFSYFALGVSLPLTVLMTVIQGLFWPTLDTSFKPVFDTWIS
VMVVFNFAGAIGLVTVRARAGHSTLLQSLWEGVKHLPAIIVFFSGITYHVAASILAYFFS
VRMTWQATSKDFQQTSIKQVIRRFWHCYLTMTLLLVVSVVAVSPLVPLGWRIGTFTILFP
LFLAIIMHFLFPILLDPGILHKFIPRYYAAKAKAVEPSRAFFYGANAEGAQPGQFRMTFD
DEKAGMHKSSSS

Enzyme Prediction     

No EC number prediction in KIS69152.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	604	816	1.7e-44	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.14e-40	604	816	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	6.16e-11	602	897	138	407	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.61e-08	565	692	39	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
237800	PRK14716	8.03e-06	687	912	237	467	glycosyl transferase family protein.
133029	GT_2_like_c	0.006	594	636	62	109	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDU25172.1|GT0	8.56e-157	325	980	233	875
SJX61509.1|GT0	1.17e-156	336	980	233	862
CBQ70834.1|GT0	2.21e-156	336	980	293	922
CDR88141.1|GT0	3.34e-156	325	980	225	863
CDI54392.1|GT0	2.25e-151	314	977	296	933

PDB Hits     

KIS69152.1 has no PDB hit.

Swiss-Prot Hits     

KIS69152.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000001

TMHMM  Annotations     

Start	End
802	824
837	859
879	901
924	946
952	974