CAZyme Information: KIS69149.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS69149.1
• CAZy Family: GH30
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
983	CM003146|CGC2	108380.95	7.0213

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003146:938560-941577(-)

Full Sequence      

MSIIATMEQVSSLYSTGIKEGWISANESSGIILADGFFPTENAASLSKWRDALSDIAANV
SSANCLVLAANPIVSTLLQQHEASDSSDVIYLSRRRGMINTISIFADAKSAIDFYTHANN
SVQAPLQFVLRQESTLGLFHSNPRLLRNLARDIDARIFRFLAARMGQHSITSSSNPSLTT
VPPGVLTRPSYSDNISGGALTPASIFTQHSQQVPQHYFVPSLRAYESSSSHSIGNNTGSD
DDASILAEKPILPSPVVTDDPITGEKKLQQDRKVRYLAPLVTGLGLGLNVFMMSGFLAKI
VIETLVDGNYARFAFIILLPFFMLVSQFLWENLAACLAQVLFPIRQMHENSLYYSGQASE
PLPPDHVLPQFTINMPCYKEGLSSVLAPSLESAMDAVRAYRAVGGVANIVVSEDGLRLLP
REEAEERIRYYNAMGVGWVARPRHSSEQGGYVRKGRFKKASNLNFTYNLSLRTEEILETS
SIDGDLEQRYSDALAQAVEETNGRVWASGNIRIGDYILLIDSDTRMPVDCLIEAAAEMER
CPEVGALQHCSGVMYVQNHYFERFIGYFTSACVNFSISWICANGAMAPLMGHNVFLRWKA
VQEVSNLDTDGERTFFSPHHVSEDFEMALKLQMKGYVIRWATYSDQGFTEGVSFTPEDET
ARFQKYAYGCSEIVFNPLRYWFTRGPLSKLFRTFIASDVNTSYKIATLSYLSTYYALAIS
FPVTVVVFVIQGLFLPYLDPIFLPSFDVLITVTLIFTLAGGLGLVTARARSGHASFGRAA
LQAIGHAPAMAVFFSGLAFHVMTALAAHMFGYNMTWGSTNKDFKQSSLKEVLRRFWTVYM
VMIAFLVTVVVASSPLIPLKWRAESFQLLVPPVLLCSMHILFPILLDPGVLEKYLPDIGQ
NEFALKLKSKHQAFFHTAGQRVKSRYITHFSNAASRNDTSAVGVSHQSDAAGSEKNAQIC
RTPSLSSNTPPMRISAGAGAGGV

Enzyme Prediction     

No EC number prediction in KIS69149.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	516	729	7.3e-51	0.9898477157360406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	7.36e-45	516	730	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	9.77e-11	514	816	138	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	8.48e-10	491	610	67	175	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133034	Glucan_BSP_MdoH	8.56e-05	487	669	53	250	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
132997	Glyco_tranf_GTA_type	2.15e-04	472	568	39	130	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX61509.1|GT0	2.12e-174	260	891	224	862
CBQ70834.1|GT0	2.58e-172	270	891	292	922
CDU25172.1|GT0	8.01e-171	228	891	206	875
CDR88141.1|GT0	1.58e-170	270	891	233	863
CDI54392.1|GT0	3.48e-169	272	888	319	933

PDB Hits     

KIS69149.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3BXV7|OPGH_XANC5	1.21e-06	517	651	241	375	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=opgH PE=3 SV=1
sp|Q8PPR7|OPGH_XANAC	1.21e-06	517	651	241	375	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=opgH PE=3 SV=2
sp|B0RNI5|OPGH_XANCB	1.59e-06	514	651	236	375	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=opgH PE=3 SV=1
sp|Q4UYZ8|OPGH_XANC8	1.59e-06	514	651	236	375	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=opgH PE=3 SV=1
sp|Q8P532|OPGH_XANCP	1.59e-06	514	651	236	375	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000019

TMHMM  Annotations     

Start	End
276	298
308	330
713	735
745	767
788	810
835	857
864	886