CAZyme Information: KIS69146.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS69146.1
• CAZy Family: GT8
• CAZyme Description: Erythritol-mannosyl-transferase invovled in MEL production

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615		68131.62	8.5671

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003146:927933-929869(-)

Full Sequence      

MKVALLANPARGEINVLLATAYELIRLGHDVTFLTGSSFANAIAEFRSEQNDPILAARIH
FSDLGNARAVEDFTRGMQSHLKGLRKPPGDYSSMEICQIVALVTEQEFRDAATMVRDRLL
EIEPDMIAVDALSPNLVTGCRMTGLPWMFTVPCSPSLTATRKSLFDPHPMGRRRQRTLMS
ALENLKLTFIETYRNATKKDLYARRALLKNEFGLNSMGFNGDSAIVPPLWKDRNCVGGIH
FNTPGLTDSIRQPHQIHFVGAGVTSDPENHDTPVFEAASFLKQLSPSSSTTFKPLFPPLS
KTGRDLDVEWMDEAYAAGQLVVYLNMGSMFLWTDAEVRSCLRAFERLYEQSGGKIKLLFK
LNKPKRTPNNTGASTPTAPISSPDFEEKQRTVMGSARPVGASNLVSEKLADAIKNVTPRR
KTDADKGYSQFTLSEFEGLEYVRFTRWVHDQRSIYKHPALRVVIHHGGGNSFNEAVHYAL
PQMILSQWFDTHEYAILAERFGIGLRSKHAPKIDENDLVNTMTRLLQGPEAEKIRRNAKV
WSIRSRNAGGAPAAARLIEAQAMLFNQQKQLELAASEVRAAVDTLSGKSSVADLESETAF
TPNMLSGAASTVGSD

Enzyme Prediction     

No EC number prediction in KIS69146.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.91e-22	1	560	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.92e-06	1	560	2	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
178170	PLN02555	0.001	451	541	347	442	limonoid glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDU26159.1|GT1	0.0	1	615	1	618
SJX63359.1|GT1	0.0	1	612	1	613
CDI53946.1|GT1	0.0	1	614	1	613
CBQ73522.1|GT1	0.0	1	581	1	585
SAM82152.1|GT1	0.0	1	612	1	615

PDB Hits     

KIS69146.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0D1DZV5|EMT1_USTMA	0.0	1	615	1	615	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	0.0	1	612	1	614	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	1.61e-06	437	535	346	451	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	6.65e-06	442	558	366	502	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KIS69146.1.