CAZyme Information: KIS68474.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS68474.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
931	CM003148|CGC6	104569.19	6.2837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003148:517031-519826(+)

Full Sequence      

MASNFSRSGLMTHATQAFHAISTATFPAGKRMSESGSPADGLSAYYVHNPSSTHAPGSEI
PKETTLQFHLAQQIAEAMYLKARRINLVREGSGIDGIFLRAHDNIYAAYPVDAYQSVAMT
SIQKLRCEAAIIINSDIIDSALSKLRPGQTELILTPQQRVQVVKDLDSLWSCRKGQGAAF
IQAEAIMVVWTEDGKDLMDAALSFQNSVLEYFEALRRGNYWGSLTSYSSHKKSIYGHSKS
NSMASSAASSQTQLHSFASQSDLAHGKFGNHKPSPSHANSWNEKTQDFSETSMDESMEAG
IVHELTTAKRPVYNLAPLLTGLSLGLNLLLSGIFMRNVLVTCVTLNNYWYLFALLAIPFL
MMLTQFFTDNILGCIAQILLPYGQMKKNSLYYSGEKPVPLPIDVQLPSITIQVPVYKESL
EGVIAPTILDMKRAMKKYELQGGKANILVCEDGMQLISEEEQQARKEFYQTHGCGWVSRP
GHGHNGFVRPGRFKKASNMNFVIDFSYDVQQLLDGGRAQNYDEALEMALQARNGIAQAEG
EVRLGDYIFLIDCDTRIPVDAFLDAASEMESSPEVAILQHCSGVMYVADHFFENMMGFFT
DIVNWSISWLVACGATAPFVGHNAYIRTAALLQVSERDPKTDQLITWSESSVSEDFDMSL
RLQLQGYVVRWATYSNLGYLEGVSLTPSDELNRWQKYAFGCSEIIMQPLRLWLTKGPLTP
LFVKFITSDKCSLSQKITVSSYMFSYYALAMSLPFAICMFIVVGLYENETRQYIVDSFKI
WLSILVIFSAAGTTARLLCFLRSRQEGFLNALKRQFVYFWPMIVFFSGLPYHILLAILAH
PIEYNMTWAATQKDVQETSLLDEIKEIMDRYWDCYLVIASFLALMLLFGTRLLSQEFCIY
GINLFWPGSITIAGHFFYPILLSPVFMRFNF

Enzyme Prediction     

No EC number prediction in KIS68474.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	547	764	2.2e-45	0.8984771573604061

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.26e-40	547	750	1	189	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133043	CESA_CelA_like	3.79e-12	407	671	1	202	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	2.60e-11	545	848	138	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	1.54e-09	396	667	248	456	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	2.29e-09	411	655	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX63876.1|GT0	0.0	1	931	1	940
CDR87449.1|GT0	0.0	1	931	1	939
CDI54392.1|GT0	0.0	1	931	1	940
CDU25172.1|GT0	7.16e-192	83	931	10	879
SJX63886.1|GT0	2.30e-186	96	931	24	878

PDB Hits     

KIS68474.1 has no PDB hit.

Swiss-Prot Hits     

KIS68474.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000007

TMHMM  Annotations     

Start	End
871	893
900	922
312	334
346	368
602	624
744	766
781	803
816	838