CAZyme Information: KIS68471.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS68471.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
947		104787.79	6.1583

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003148:507348-510191(-)

Full Sequence      

MQRVDSSSSVPSLSTLPALNTNPAVASSVASHAGKYYHQDQEDDMEVMESDDEDRINPSS
SASSSNNHYYGHPSSAKAQRSSFKRRSDSYILTTAPSAGSPGSYTFHSTAEDSTESGASA
DAIHASLVLARHIFSVAVTEKWCRQDNFSNAVAVRLQVGSYILYPQEGSSMPAFSRAMLE
LNCDAAIIINTPLVAAALSTLNPGETEIRLSSSKRVQVVHSLDYLGGARRAQMAAFSDTE
QVLVIWTESCRDLIEQVRSFERLMVDYVWSITADPTASARQSSISRSPSLMSFNTTVDNS
GITPSGSAESDLQQLVNYVPEVRSVQSFAGAVRGLSICMATVVIANWIRQIVQAVRLDGE
PIYLVVLLAIFPMFLVILPLTDNVASCVAMAIGPIRPMMRNSRYYSGVTPVAPLGKTILP
HVTIQVPVYKESLKHVLQPTLDSVRAAITEYELQGGTASILIGEDGMAVIDEEERQTRLD
FYRRHDIAWIARPRHGDMFERAGRFKKASNLNFSMQISKRYEEEILANPNQDREALLQRI
LKERHPQAEGEGDVSIGELILIIDSDTRIPADSLLPSAWEMTSSPEVGILQHCSGVLIVG
SGFFEKSLAYFMRFVYFFISWQTATGEVAPFVGHNAFIRKSALSELAEESLSNKNSEGLI
KPWSEETVSEDLDLGLRLLLKGWVTRWATYSNYGFQEGVSLTYVDELNRWRKYTYGIFEL
FLNPLWRWPVHGPVPKLIRTVFWSSKVPTHYKVHLLAYAASYIAIGVSLPSALGLYFVQG
WLGPWLAPFFISSFQYWVVSLVIFGATGFIGVTIARHRSGDANIFVALGQHLLWYPINLI
TIISLSFALIKASLIYLVSLPISFGVTAKDDSDFHFATEAPLVLRQFWQSNTLCIAIIAA
VSVLATSAVPLGWQITEWPTMLPIMVIAVSTLLSPFILNPALIRFSF

Enzyme Prediction     

No EC number prediction in KIS68471.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	560	791	1.8e-48	0.949238578680203

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.81e-32	559	778	1	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	9.77e-08	557	670	79	179	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.42e-05	362	858	2	416	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133034	Glucan_BSP_MdoH	0.003	558	645	97	185	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
225494	MdoH	0.007	560	728	244	410	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX63879.1|GT0	0.0	1	947	1	949
CBQ74035.1|GT0	0.0	1	947	1	949
CDR87456.1|GT0	0.0	1	947	1	948
CDI54395.1|GT0	0.0	1	947	1	946
CDU25172.1|GT0	4.53e-201	146	947	19	879

PDB Hits     

KIS68471.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3MB01|BMGDS_TRIV2	3.70e-06	557	715	191	335	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
sp|Q8YMK0|BMGDS_NOSS1	3.70e-06	557	715	191	335	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000001

TMHMM  Annotations     

Start	End
329	351
361	380
756	778
793	815
822	844
848	867
887	909
924	946