CAZyme Information: KIS67588.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS67588.1
• CAZy Family: GH15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	CM003152|CGC4	43821.69	8.9153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003152:588722-590143(-)

Full Sequence      

MRSVASYIAASLLMAAGCALCQGPPPPWPGGHQFIGQPPQAPVDPLSSSHWRPVSASSTR
VGAIGAGAGIQPRPFGEPAGFAGSEASTGRGPLPGAYPFMGRAGRTPDASPGGIPSAQGG
MMGGSVGGNAGSAMSDQLRLESDFPGKPTAAIMYTYVPSTFKKGNPVIVALHHCAGTGPG
YFHEYADWPKMADKKGFLMIFPSSPGGTGNCWDVSSKASLEHNGGGDSQTIAEMLKFAIK
KYSCSDKAYLVGHSSGAMLTQVMATTYPDLFVAAAAYSGVPSGCFSTQKAKGADWNSTCA
GGTLNESLQYWVQQARNMYPGYKGQYPRMMLVHGDQDAVINFNNHREAVKQWCGLHDLNP
ETPDKKYPLPSQPNYEISVYGSSAVMAISAGHVTHDNPAKGMRLRGLSVLIRLKKPS

Enzyme Prediction     

No EC number prediction in KIS67588.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	153	352	4.1e-21	0.7929515418502202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	4.15e-28	153	364	1	205	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	4.32e-12	132	288	32	189	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	1.89e-07	151	344	380	569	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
402228	Esterase_phd	2.82e-07	164	362	15	205	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
223477	YpfH	2.94e-05	153	279	3	132	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX64757.1|CE1	7.01e-145	1	400	1	369
CBQ69118.1|CE1	8.03e-144	1	400	1	379
SAM83560.1|CE1	7.66e-136	1	400	1	345
CDR88945.1|CE1	1.03e-125	1	400	1	417
AEO58247.1|CE1	1.47e-70	138	401	42	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	8.84e-72	135	408	1	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92194|AXE1_ASPAW	1.11e-70	135	408	30	304	Acetylxylan esterase A OS=Aspergillus awamori OX=105351 GN=axeA PE=1 SV=2
sp|Q96W96|AXE1_ASPFI	1.20e-69	135	408	29	303	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|A2QZI3|AXE1_ASPNC	9.42e-69	135	408	29	303	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1
sp|A1CSZ8|AXE1_ASPCL	1.71e-67	138	403	36	299	Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=axeA PE=3 SV=1
sp|Q4WBW4|AXE1_ASPFU	8.15e-66	135	401	31	295	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000677	0.999304	CS pos: 17-18. Pr: 0.7913

TMHMM  Annotations     

There is no transmembrane helices in KIS67588.1.