CAZyme Information: KIS66936.1

Basic Information

• Species: Ustilago maydis
• Lineage: Basidiomycota; Ustilaginomycetes; ; Ustilaginaceae; Ustilago; Ustilago maydis
• CAZyme ID: KIS66936.1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679		74984.90	5.3530

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Umaydis521	6910	237631	145	6765

• Gene Location: location=CM003155:301944-303983(+)

Full Sequence      

MSASSAAAAARYQPISTQTPNLSQPRTQPRGSSRIMNRDQDANDRAGLLGQDPDHDVASY
SRPFRTDPSPNVSHSNIVQPGRGTSTIHSYSTGSQSTNNGTAMPRFMGAYRATAPNSESD
LSVHSSSQFSYATNAEKAAYASKAGAAGIASSFQDEDDDWLHDPKAKSTVGTAESLTSMR
GLLNVGTLLLIGLCLLMLFLGYPVLIEIRKKYADGTASASLSTTTTFTTFPVNMKRGLVD
QETPQSAYKRTSPVDNSAWHLVFSDEFNTPGRTFWPGDDPFWEAYNGWYSGTNDYEYYSP
EAINTTDDGYLQISFEERETNNLNFRSGMLQSWNKACFTGGYLEINAQLPGTPDAAGFWP
GLWLMGNLGRPGYNGVNEGIWPYSYAGCDTGALPNQTWINGTGPHHAIVANGQFSYQVNH
KLSYLPGLRFPACTCPGEDHPGPNNNVARSSPELDMLEATIGANGGQSSQSLQVAPFDID
YFYNNVSGTDYIIHDRDTTKINGYHGNELQESVSALAAIPDRAYQRHANAGFVNFGVEWE
PDMNGDGKGLDGETDAYITWYIDDKPTWTLKASALTGVPELDISRRLIPREAMSMIVNLG
MAYNFQPPVWRQLQFPGTLKIDYIRMYQRDGRDDRVSCDPNELPTRKYIERHSDIYQNKN
ISRFPKDRIPKNRLTHPGC

Enzyme Prediction     

No EC number prediction in KIS66936.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	265	627	5.8e-128	0.9969325153374233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	149	679	2	500	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	1.63e-133	261	628	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	3.97e-30	237	640	28	353	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	1.19e-20	263	627	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	1.55e-06	259	382	2	126	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDI55597.1|GH16_2	0.0	2	679	5	673
SAM85435.1|GH16_2	0.0	12	679	13	676
CDI56241.1|GH16_2	7.34e-212	155	679	61	570
SJX65884.1|GH16_2	2.80e-206	178	679	91	579
SAM64974.1|GH16_2	2.26e-205	115	679	23	579

PDB Hits     

KIS66936.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	9.40e-105	150	675	206	708	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	2.28e-104	156	679	257	763	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87023|KRE6_CANAX	1.30e-101	234	679	327	740	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|P87024|SKN1_CANAX	2.37e-101	234	679	331	737	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|O13941|YEPB_SCHPO	5.35e-99	156	676	132	625	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

Start	End
182	204