CAZyme Information: KID71695.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID71695.1
• CAZy Family: GT4
• CAZyme Description: glycoside hydrolase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
692		77172.96	5.0507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000001:4429818-4432020(+)

Full Sequence      

MADTSYPRPDFVRAGLHWESLNGAWDFIFDDGDVGLQNRWQDAGLPSEIAVEAVDGGSND
GLGGEGDSITQRIAAGTQELLPGNALSRESAIINRKRQIHVPYVFQCPASGINDRGVHQV
LWYERSVADLRSSQEKDRGDKLLLRFGAVDYEARVWVNGREVGGHRGGHVPFDIDVTDAV
DQAGAGPHRITIRVYDSAYDLTQPRGKQYWGAKPESIFYTPSGGIWQSVWLEVAPGARIA
DSSHGTVLRSNGIDSGTLHCHVAVLGRRVGRNYSIEMESWFGGVSVSKSGLTALPNDKDS
VDVELKMRMSENQKSSLLPGTIDTDSLQNPSCWKDGVALWSPEHPLLYDITINLIDTSTG
NVLETVKTSTGMRSIEWQAGDGYWRLNGKPYFQALCLDQGYWPETFMTGSSDEIKHDIEL
AKKMGFNGCRKHQKVEGPLFYYFADKLGYLVWAEMANAYQFSREYIDRFNQEWVESVKLA
INHPSVVTWTPVNESWAYTSLQDSVEQRNHIRALYFLTRSLDSTRSINDNCGWEHVHTDL
TTFHDYSDGPELAKTCASLDAILDKKAGRHLFVPAIEGLDQGAQHVPGTPIMCTEFGGVN
IAPAKDSGEDVRDWGYTTASNSADLLTRFEKLVRGVTDGGHCCAFVYTQLTDIEQEANGL
YTFDRTEKLSSERVKCIIDESLRQWYERISHA

Enzyme Prediction     

No EC number prediction in KID71695.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	17	545	4.6e-89	0.4867021276595745

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	2.86e-27	20	527	14	445	beta-D-glucuronidase; Provisional
225789	LacZ	3.56e-27	19	541	13	463	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	4.00e-18	139	525	125	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	3.91e-11	19	235	2	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
397119	Glyco_hydro_2_C	3.35e-07	412	527	36	158	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI71253.1|GH2	0.0	1	692	1	692
UNI20501.1|GH2	0.0	6	690	8	690
UPL03470.1|GH2	0.0	4	692	2	690
ANH56458.1|GH2	0.0	3	692	6	694
QKD54841.1|GH2	0.0	5	689	2	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	2.20e-57	98	675	64	576	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6D50_A	1.07e-19	99	494	65	426	Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
5UJ6_A	1.07e-19	99	494	57	418	Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D8G_A	3.25e-19	99	494	65	426	D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
6ED1_A	2.05e-17	120	498	78	425	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	9.83e-20	99	525	82	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	1.08e-18	120	538	57	429	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|O97524|BGLR_FELCA	5.61e-16	110	527	81	478	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|O18835|BGLR_CANLF	6.85e-15	110	527	81	478	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|Q4FAT7|BGLR_PIG	6.86e-15	121	527	100	479	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KID71695.1.