CAZyme Information: KID71448.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID71448.1
• CAZy Family: GT34
• CAZyme Description: Glycoside hydrolase, family 76

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276	AZNF01000001|CGC19	30473.14	4.6944

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000001:3572599-3573555(-)

Full Sequence      

MKLPSSPLMLLAAGRLSVAASVFSLDSDDEIKKSASILAWDMLQYYHGNESGGTPGVLPG
PPPAGDYYWWEGGAMWGTLIQYWALTGDSTYNNIIMQAMQFQVGEGQDYMPRNVTASLGN
DDQAFWGMAAMLAAENKFPDPPANRPGWLGLAQAVFNTQASPQRHDSTCGGGLRWQIPFT
NNGYGYKNSIANGCFFNMAARLARYTGDTKYSDWAEKTWDWVEKTGFIDPKNYAIYDGAN
VAHQCKDINKVQYSYNNAIFAEGAAFMYNIASLSLY

Enzyme Prediction     

EC	3.2.1.101:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	271	2.4e-76	0.6229050279329609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.61e-122	31	270	2	234	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	8.37e-07	170	260	133	214	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI71374.1|GH76	4.81e-206	1	272	1	272
UNI24914.1|GH76	2.17e-169	6	269	6	269
ANH56460.1|GH76	4.13e-155	16	272	20	276
QLI70208.1|GH76	4.78e-152	4	269	9	274
UNI20931.1|GH76	2.10e-148	4	269	7	273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.05e-117	23	269	28	276	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]
3K7X_A	9.00e-06	148	276	113	234	Chain A, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	2.54e-81	16	269	15	267	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	3.51e-80	8	276	3	269	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	2.39e-78	25	276	26	272	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	3.90e-75	20	276	17	268	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	3.89e-71	25	269	21	262	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.776472	0.223540

TMHMM  Annotations     

There is no transmembrane helices in KID71448.1.