CAZyme Information: KID70905.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID70905.1
• CAZy Family: GT31
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42088.79	6.1803

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000001:1667541-1668662(+)

Full Sequence      

MPLTAHGFSAAEIHSKIQLLINGLVNIKDDTGEFLMTLADGRVIDTKGWNDWEWTHGIGL
YGIWKYYQTTGDARHLQIIEDWFRDRFAAGGTTKNINTMAALLTLAYVYDQTRNPTYLPW
LDNWGEWAYRDLGRTKHGGMQHTTYLEDNDQQLWDDTLMMTVLPLAKIGLVLDRPHYVAE
AKRQFLLHIQYLFDAKTGLFFHGWTFRDGGHHFASARWARGNSWLTIGISEFIELLDLGR
SDGPLCSHLQATLAAQCEALKTLQSPNGLWRTLLDVSEEDGSYGESSATAGFAFGLLKGQ
RKRYIQGEYQHAAFKAVRGVLENISPDGQLQNTSFGTGMGSDLEFYKKIPITPMPYGQAM
AILALVELLNIFI

Enzyme Prediction     

No EC number prediction in KID70905.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	47	369	5.9e-104	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	9.12e-104	24	369	8	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.13e-97	26	369	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI63582.1|GH105	1.57e-280	1	373	1	373
UKZ54323.1|GH105	4.12e-237	1	373	1	372
UKZ80096.1|GH105	4.12e-237	1	373	1	372
QYT01859.1|GH105	3.38e-236	1	373	1	372
UKZ93203.1|GH105	3.49e-222	8	373	8	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	1.42e-199	9	373	4	373	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	3.78e-154	6	370	19	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.15e-146	11	370	25	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	5.54e-39	52	370	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	4.92e-09	169	321	10	163	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	4.92e-09	169	321	10	163	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KID70905.1.