CAZyme Information: KID70844.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID70844.1
• CAZy Family: GT2|GT2
• CAZyme Description: Chitobiosyldiphosphodolichol beta-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A0B4GRW0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	AZNF01000001|CGC3	53348.75	7.2833

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000001:1483822-1485370(-)

Full Sequence      

MDAAFFLSLSAGVVSVFLMKYGLQALKWLASALYYSIPTRYKAAQRPEDDHIQILVLGDI
GRSPRMQYHAISVAKHGRKIDIVAYKETARHPDLIGNERVSMYALAPQPEWIAWGTLPFF
LNIPCKVIQQFWTLFYTMMWATPAAKWIIIQNPPSIPTFHVALIVSLIRGSKVVIDWHNY
GHTILAQKSLYSIFVPFYKWYEIILGKFLGNANLAVTDAMARELRGPKFNLKNPVHTLHD
RPLDLFQPITSTKARKEFLSRLPETKPHVGNILDGTMRLIVSSTSWTPDEDFNILLEALV
LYANPSEDDASSEPPSPVLAIITGKGPEKEKYLEMIKQIQDNGRLPGIQILTAWLSNRDY
ASLLGCADLGISLHKSSSGVDLPMKVVDMFGAGLPVAAYSAFESFSELVKEGQNGCGFET
AAQLTEILKRLFSEKGQDELAQLRKGAVEEGSLRWDEEWDRVMAPIIGIDTKAGAVR

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	51	465	8.6e-142	0.9905882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	0.0	51	467	5	411	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	2.86e-130	51	432	6	371	transferase, transferring glycosyl groups
340831	GT4_PimA-like	1.88e-08	155	469	90	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340844	GT4_UGDG-like	3.91e-08	201	431	124	342	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
340825	GT4_WbuB-like	1.01e-07	148	449	102	375	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64698.1|GT33	0.0	1	477	1	477
QPG94736.1|GT33	1.66e-299	1	469	18	486
QUC22591.1|GT33	6.45e-290	1	469	1	469
UNI21879.1|GT33	3.14e-260	1	469	1	468
ANH56527.1|GT33	3.56e-259	4	473	4	442

PDB Hits     

KID70844.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZD1|ALG1_ARTBC	4.43e-101	37	471	23	447	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01551 PE=3 SV=1
sp|O13933|ALG1_SCHPO	3.97e-86	29	467	4	420	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg1 PE=3 SV=2
sp|Q6C3K2|ALG1_YARLI	6.29e-82	54	469	44	440	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG1 PE=3 SV=1
sp|Q9BT22|ALG1_HUMAN	3.57e-81	51	467	34	461	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
sp|Q5R7A2|ALG1_PONAB	5.03e-81	51	467	34	461	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995109	0.004916

TMHMM  Annotations     

There is no transmembrane helices in KID70844.1.