CAZyme Information: KID70746.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID70746.1
• CAZy Family: GT25
• CAZyme Description: DUF1237 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	AZNF01000001|CGC14	59329.58	5.9134

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000001:1138344-1140499(-)

Full Sequence      

MRIPSLIHTGVAALVAILPATHASWQDYEAQARTPASCPDYTDYSQKPHAPYSEGPLKLP
FMRPSEECRTFTSPAVEKVIRDMKARIRDADLARLFENTFTSTLDTTVKYFDPRVNLAFI
VTGDITAQWLRDTGNQFAHLYKLLPQDDNLKALVKAIINTEARYIYQYPYCGMYHHYREL
QSGLKPTVNDYAAKVNVNPPVDNQTVFECKYELDSLAAFLKISRSYYQNTQDASFINDNW
EKAMNKILQTINEQSQSSWSDDWEFVSYYNWTGTAGSLSPPVPNSGNGEPKLANGLVACS
HRPSDDLCVFNFVTSDNAMLSVELGHVADLLDASRKLNQVSRQARQYARTIRNAVLHHTK
TPNGIFAYETNGYGGQYIMDDANVPSLVSLPYLGFLPRSDSTYRKTKDAMFSRSNPYYAV
GKKFQGIGGPHVNATYPWPMSQVSGIYGTDDDDEIKERLALILENTSGLGLIHESVHIYN
TSDFTRPWFAWANSYFAEMVLDLAERKPGLIFKDDTPYIVGGDDEK

Enzyme Prediction     

No EC number prediction in KID70746.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	89	501	1.2e-124	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	89	501	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	3.21e-117	68	510	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64981.1|GH125	0.0	1	526	1	524
QPG95090.1|GH125	2.12e-304	1	521	1	508
ANH56490.1|GH125	5.36e-303	12	523	10	555
QPC58042.1|GH125	2.39e-298	15	521	14	518
CEF76467.1|GH125	3.94e-297	15	521	14	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	1.28e-72	63	503	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	1.89e-72	63	503	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	2.77e-71	63	503	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
6RQK_A	8.39e-69	76	502	12	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	4.54e-68	76	502	12	421	Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.13e-122	37	514	26	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000516	0.999450	CS pos: 23-24. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in KID70746.1.