CAZyme Information: KID70536.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID70536.1
• CAZy Family: GT25
• CAZyme Description: Mannosyltransferase, DXD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	AZNF01000001|CGC21	45132.19	10.0635

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000001:399999-401344(+)

Full Sequence      

MASLLRPAPLLLIAALLRVALLVYGTYQDAHSAIKYTDIDYLVFTDASRYVWHAQSPYAR
DTYRYTPLLAWLLLPTVSFFAFGKVIFALADLLAGWLILRILRRRGIPPEQAGAFAALWL
WNPMVATISTRGSAEGLLGVLATALVWAAEGHRVNLAAVLLGLGVHFKIYPCIWAPAIAW
WMDDDRPRRKQASRFLSRDRIQLAAVSLATFTGLNVLMYAVYGRPFLVHTFFHHLTRIDH
RHNFSPYNVLLYLASSRPGIPLHAESLAFLPQLSLSCVLIPLVLAKKDLATSMMAQTFAF
VTFNKVCTSQYFLWYMIFLPLYLPTSTFLRKPRLGMTALVLWLVSQGAWLHQGYELEFLG
RSTFFPGLWASSVAFYLVNCWILGVIISDGGARTAPKARTE

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	128	387	1.1e-91	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	3.15e-86	23	387	24	415	GPI mannosyltransferase
252941	Mannosyl_trans	3.30e-71	128	387	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	3.61e-08	53	223	46	229	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI66163.1|GT50	2.24e-278	1	401	4	428
QPG95205.1|GT50	1.09e-211	4	398	7	417
UPK97783.1|GT50	1.81e-202	4	401	7	424
UKZ48798.1|GT50	1.05e-199	1	397	6	412
UKZ75326.1|GT50	1.07e-199	1	397	6	393

PDB Hits     

KID70536.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	7.29e-197	2	401	5	418	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.34e-164	6	391	25	486	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	1.08e-158	6	389	7	409	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	3.53e-157	17	391	18	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	1.86e-156	6	391	7	429	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.592421	0.407573

TMHMM  Annotations     

Start	End
10	27
68	90
159	181
201	223
268	285
306	328
365	387