CAZyme Information: KID70502.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID70502.1
• CAZy Family: GT22
• CAZyme Description: Glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647		69210.62	6.1085

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000001:295377-297320(-)

Full Sequence      

MMMRSSWQAALAGLSLLGSLAAAANLTGYEYVVVGSGAGGGPLAARLALAGHKTLLIEAG
DDQGNNPNYTVPAYSARASEDEKLAWNFYVRHYADDARQARDYKTSYRTADGALYTGLNP
PAGAEMLGTLYPRTGTLGGCTAHNALVAIYPHRSDFEYVASLTGDASWAPDNMRKYFVRM
EKNRYLLPLLAKGHGFDGWLDTERAPITLPLEDPKLLSLIAGGSFALGNYSRLLPNLLDV
ALGDANEDSEARDRDGGYFQIPLSAGDGRRYGSREFVVATRDAKNPDGSKKYPLDVRMNC
HVTRVVFDTSGGDEPRATGVEFLDGAYLYRASPRSGSAAKGVPGSATASKEVIVAGGAYN
SPQLLKLSGVGPASELAQFGIPLVKDLPGVGTNLQDHYEVAVQGRLPSDWRFLAGCTFSD
DNDPCLDRWRRPGLLTGRGAYVSNGFAAAMLMKSSVATEYDAFLFGGPVNFRGYFPGYSY
NITADHDVFTWAILKGHPRNTAGHVRLRSADPLDVPDVLYNYFDTGSGDSAADLTAIREA
IGVARDAFSRQLVGVDEVLPGAGVRSAAEVEAYARDTAWGHHASSTCPIGADGDPMAVLD
SSFRVRGVKGLRVVDASVYPRIPGTFTALSTYMVGEKAADVILSQNK

Enzyme Prediction     

No EC number prediction in KID70502.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	28	644	1e-90	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.80e-68	294	643	216	532	choline dehydrogenase; Validated
225186	BetA	4.34e-57	43	644	22	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.12e-30	503	638	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.15e-19	129	399	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.30e-17	268	635	218	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI66121.1|AA3	0.0	1	647	1	647
UKZ86508.1|AA3	0.0	2	647	26	667
QPG95226.1|AA3	0.0	3	646	1	640
UNI19331.1|AA3	0.0	14	645	10	646
QMW33146.1|AA3	0.0	11	645	6	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	3.17e-40	29	642	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.46e-39	29	642	8	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	1.46e-39	29	642	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.46e-39	29	642	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.75e-39	29	642	24	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6U6Y8|BETA_SINMW	3.76e-41	30	645	4	528	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) OX=366394 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	4.37e-41	29	643	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	2.05e-40	29	643	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|P54223|BETA_RHIME	3.28e-40	30	645	4	528	Oxygen-dependent choline dehydrogenase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=betA PE=3 SV=2
sp|C3MIE4|BETA_SINFN	4.47e-40	30	645	4	528	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000621	0.999363	CS pos: 23-24. Pr: 0.9676

TMHMM  Annotations     

There is no transmembrane helices in KID70502.1.