CAZyme Information: KID69528.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID69528.1
• CAZy Family: GT15
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	AZNF01000002|CGC15	39620.52	6.6359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000002:1583667-1584764(-)

Full Sequence      

MTSKCSITGLASYLALASSFFAKEVHSATKAQYTREASTAIKALNSNWYKQDTGLWDDAW
WQSANALTTLADFAVLQPGAAKSLGIADTIGNTVKNAPKKFPGFVNQFYDDEGWWALGLI
HSYDATRDASYLETAADIFNNMQTGRGTPCKGGIFWNKDREYVNAIANELHITVAASLAN
RIPTNRTYAQIAKDEWHWFQKSGMINSQNLINDGLDSNCKNNGSQTWSVNQGVILGGLTE
LSRDSLLGAGVLDTARTLAMAAIQALSNKDGILVEIDKCETQKEACGFDGKQFKGVFIRN
LGYLNQALKDGDIRAFILKNADAVWNKDRDDTNKMGVSWTGPVIAANGASHGSALDVLVA
AVRVA

Enzyme Prediction     

No EC number prediction in KID69528.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	24	349	3.3e-78	0.8910614525139665

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.62e-25	37	340	6	331	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	5.96e-18	11	365	4	350	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI72543.1|GH76	1.30e-261	3	365	2	364
QPH18857.1|GH76	6.75e-193	1	364	1	364
ANH56416.1|GH76	7.95e-187	6	364	5	363
QPG94943.1|GH76	1.42e-136	25	364	26	401
UKZ60243.1|GH76	1.05e-132	33	364	226	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V1S_A	1.82e-06	93	235	129	271	Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	4.27e-06	93	232	129	268	Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

KID69528.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.110584	0.889391	CS pos: 27-28. Pr: 0.7964

TMHMM  Annotations     

There is no transmembrane helices in KID69528.1.