CAZyme Information: KID69102.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID69102.1
• CAZy Family: GH92
• CAZyme Description: glycosyl transferase family 17 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	AZNF01000002|CGC3	43147.22	8.7401

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000002:154321-155433(-)

Full Sequence      

MAARRCAKIILGIGLLSFIWWLFFRPTLHHSSFHQVTNTPLDLLKAALHDSRKPTEYYAS
KAARDFCAAHGYPVFTPPSVSSERKVYDLVMVNSELDFLEIRLNTLYDQVDYFIIVESPK
TFQGDRKPLVIKDNWAYFRRYHDKMIYHELAFPTSFHPHRAWDYEDLQRDAMYDQVMLTL
EGPRRPMQGDVIIVADVDEIPRPQTVLVLRTCNYPRRLTLASKFYYYSFQFLHTGPEWQH
PQATYFQGSRTLKPTNLRNGDGGFALLRGREKGVLNNAGWHCSSCFATMEQFLNKMSSFS
HGWMNAERYRVKDKIAAAVREGRDLWERQQDTFIKIEKNKDIPPLVLEEPGRFGYMTNRD
GPSAGFTDYP

Enzyme Prediction     

No EC number prediction in KID69102.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	65	356	1.6e-76	0.9753521126760564

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	7.96e-48	57	325	50	298	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI72462.1|GT17	1.49e-272	1	370	1	370
UNI21852.1|GT17	1.94e-224	1	369	1	372
UNI13286.1|GT17	2.02e-200	11	370	2	365
ANH56577.1|GT17	4.90e-197	1	369	1	373
ATY63636.1|GT17	8.31e-193	1	370	1	375

PDB Hits     

KID69102.1 has no PDB hit.

Swiss-Prot Hits     

KID69102.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000004

TMHMM  Annotations     

Start	End
7	24