CAZyme Information: KID68818.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID68818.1
• CAZy Family: GH89
• CAZyme Description: GPI-anchored cell wall beta-1,3-endoglucanase EglC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444		46083.90	5.9362

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000003:3101018-3102352(+)

Full Sequence      

MHLSTTLLASAMAMGVSAATNNILGFNSGATFADRSAKFKKDFEAEMKGAQGLKGAPGTF
NTVRLYTNIQAYSQDDPIQAFEAAMETKTQLLLGIWASGTDNIDKEINALQKAVKTYGKE
FTDLVVGISVGSEDLYRDSQTGSKNKAGVGNSPDSILKFIGDYKKSFKDSALSKVPVGHV
DTWDAWTNSSVKPVIDAVDWVGVDEYPFYENGKGNYIENAPYLFEKAYGATVNAINGKPI
WVTETGWPTTGPDWDEAKASVENAKYYWDEVGCRSLFNKVPTFWYTLRDSNPDNKVKFAI
AKDLTTPLFDLTCPKTFKTKPKSSSVVSSATGTATGTATGTATGAVNGTATATGASKPTS
TGGSGNPGSDGSNGSNGSGNNGGSGNNGGSNNGGSNTGGGSGSSTTSGATASSTVVKGAS
STVEKFSGAAYFVLAALAGSLTLL

Enzyme Prediction     

No EC number prediction in KID68818.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	66	293	1.3e-18	0.8295819935691319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.59e-24	17	273	39	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.94e-07	24	313	1	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI66323.1|GH17	3.99e-258	1	444	1	438
QPG98530.1|GH17	9.78e-187	1	325	1	325
ANH56450.1|GH17	1.65e-178	1	328	1	330
QUC16336.1|GH17	1.60e-177	1	329	1	329
UNI15929.1|GH17	4.17e-173	1	365	1	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	5.99e-17	60	289	59	268	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	3.66e-16	60	289	59	268	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QH21|EGLC_ASPNC	1.10e-92	10	313	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|Q2UUZ1|EGLC_ASPOR	2.33e-89	5	325	4	320	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	9.94e-88	5	328	4	325	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	1.38e-87	5	329	4	324	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	2.19e-86	5	368	4	359	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000423	0.999575	CS pos: 18-19. Pr: 0.9706

TMHMM  Annotations     

There is no transmembrane helices in KID68818.1.