CAZyme Information: KID68798.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID68798.1
• CAZy Family: GH88
• CAZyme Description: polysaccharide lyase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		84143.12	6.7601

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000003:3039306-3042201(+)

Full Sequence      

MRTLLGYLVLAGSGILHGVQAASRDDELALISKRRIVDLAQFPDLTWFSQISAWLDTQKS
DGTWPDVNYMSGCAAQRANWPIQVHWNRIITFAAAWSGANPAVAQNWTRSDDLMEAISRG
LDYWFSNDYTPADCMGNGGKATGGCPCGTPGLWNTNWYGQAILIPQLCSTACLLLKDANL
TKDITAGCERIPRRSYDLRDGVYGSGGRMTGANAVLVMQNSASLALYSNNATMLQDAYAR
AMSVMTYADKTMEDGIHRDGTFLQHNGILYNGNYGKDLFNAFIQLEGEAIGTSFAAGNAT
RDAIAAQVRGNEWMIFVDQQTKQEHWDFNAIGRFVAFPTQDLQANADINFNTTKLAGAVA
DFAGANNVSDTIRRLRSNGTDKLVGNKGFWASDYMVHRTKSFVLGNKMLSTRSRNTEAVN
SANPYGYHLGQGTLFSYVEGNEYKDIMGAWDWNLIPGTTTLLNHTRLSAGASANVGKKDF
VGVVSDGRVGAAVQEYADPLDGSISYRKAWFYQDDFVLITTQDIKKAVPDAPVVTVLDNR
ASVHGNIWVDGRNVQADGGRTARGKTLFYGGNGYLSYDKAFDLTLFEGKRTGNWSEISTS
SAGVTTVSIFSAYATIADTCSAYAVFPASSRGRLAKELEKPSASPIIQSGISGAVGSDRL
SLVFWPGGDGNIKLSLREIGWAESGSVNITSAQPSSYLFSGTGKRGKGMTLVVTLSDPTQ
KAASASFSLNFDGARAKLGDAAADEGRSGNETEVKYTVDLPTGGMAGSSTSRKMYVEFR

Enzyme Prediction     

EC	4.2.2.3:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	388	628	1.8e-99	0.9917695473251029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396729	Lyase_8	9.67e-64	386	630	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
238517	GAG_Lyase	1.49e-61	57	718	31	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
400444	Lyase_8_N	7.41e-16	53	310	31	264	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI65685.1|PL8_4	0.0	1	779	1	779
UNI15902.1|PL8_4	0.0	1	778	1	784
QYT05319.1|PL8_4	0.0	1	777	3	779
UKZ83144.1|PL8_4	0.0	18	777	15	778
UKZ57430.1|PL8_4	0.0	18	777	15	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	4.03e-27	30	600	8	530	CHONDROITINASE AC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	4.35e-27	30	600	30	552	ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
2WCO_A	2.42e-24	90	601	87	606	Structures of the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
2X03_A	2.96e-23	90	601	87	606	The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]
1RW9_A	6.92e-20	156	774	124	755	Crystal structure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59288|CSLA_PEDHD	2.24e-26	30	600	30	552	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
sp|Q59801|HYSA_STAA8	8.35e-08	154	600	180	661	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003514	0.996470	CS pos: 21-22. Pr: 0.9610

TMHMM  Annotations     

There is no transmembrane helices in KID68798.1.