CAZyme Information: KID68532.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID68532.1
• CAZy Family: GH76
• CAZyme Description: long chain fatty alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	AZNF01000003|CGC7	84654.95	6.3588

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000003:2085426-2088043(-)

Full Sequence      

MDAIDIGAPTPTPLPDPPVKDFMTDAQWETLYALLDGVLPCITSTTSSDVKDKNSGILLS
DTEFEALIDDCTAALLNPPSRHKIKEYLEFRPSQDENFRDDCLRSLAIVPQRNQLIKILN
LLGTVVAAPSKLLFLYAANDVDWSIQVLLTIRSRNSGHAGSMLLTGYWTPITQQPTKVRE
AILKSWATSRLTPLRMLAKALAQMAQKANAIHSPYFREISGYSDAPKDWKPVEGYEYNFI
RVPAGTGVHEITTDVVIVGSGCGGAVSAKNIAEAGHKVLVVDKGYHFPPSQLPMTQASGS
HHLFDAGGVFFSDSSSMGVACGGCWGGGGTVNWSVCFRLQDFVREEWAAAGLPLFTSSDF
DDSMDRVWDFIGASKDAIRQNPRNQALLDGTQKLGWKGGVVEQNTGGKEHYCGQCHLGCG
SAEKRGPTVAWLPAAGDAGAEFMEGFAVDRVVFAEDGVTAVGVEGTWTARDENGGVHTPQ
NTRTQRRVVVKAKKVVISGGSMWSPLILTKSGIKNPNVGKHLHLHPVNLVSAIFGKKDLA
SWEGGIITSYVDEFENLDGKGHGVKLEPVVNVPYATYSLQTWRDGIDAKLLALKYRHIGT
FIVLTRDRDTGRVYPDPRKGTPRIQYDTSDFDREHTIEGIIALAKICYVTGATEIRPHLH
HLEPFVASDGGKRQAEHQGGKDPEFTDPEFAAWIKKLRVADNQGPTAMWMSAHQMGSCRM
SADEDTGVVDMKGKVWGANNLYVADASVFPSASGVNPMVTAMALADWISRGVASELAGE

Enzyme Prediction     

No EC number prediction in KID68532.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	243	771	5e-69	0.9781021897810219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	8.03e-45	330	527	32	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	8.69e-29	607	765	1	140	GMC oxidoreductase. This domain found associated with pfam00732.
225186	BetA	9.09e-28	254	770	9	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.66e-08	686	773	456	535	choline dehydrogenase; Validated
274143	pyranose_ox	1.47e-07	713	765	483	535	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	1.58e-190	8	779	10	737
ADT70774.1|AA3_1|AA8|CBM1|1.1.99.18	4.18e-16	252	766	255	786
XP_756097.1|AA3_1|AA8	3.67e-15	240	757	257	785
AEO59298.1|AA3_1|AA8|1.1.99.18	2.48e-14	250	772	246	782
UJO19303.1|AA3_1|AA8|CBM1	3.57e-14	252	772	271	805

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	9.39e-09	243	779	223	770	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
3LJP_A	3.94e-08	494	779	264	533	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	9.01e-08	494	779	264	533	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	9.01e-08	494	779	264	533	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
4YNT_A	6.39e-07	252	750	5	542	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	3.84e-81	137	776	92	746	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q9LW56|FAO3_ARATH	4.48e-76	251	776	231	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|B5WWZ8|FAO1_LOTJA	9.07e-76	250	776	234	744	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	3.85e-71	145	776	87	742	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|Q9ZWB9|FAO1_ARATH	5.64e-69	249	773	242	749	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KID68532.1.