CAZyme Information: KID68410.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID68410.1
• CAZy Family: GH75
• CAZyme Description: Lipopolysaccharide-modifying protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627		72852.06	6.9995

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000003:1637851-1639734(-)

Full Sequence      

MLRRQLTVFAAFIFFTVCIYSALRLSHQETKLVVKQTGDTRPDQSPLKPSLHEVQKLEST
LTLAYEPTTINDARPKPTQEEELQEDWGDATTIHGGPRAKDVLSSKRHPIQHLMTDARRE
LEGTTKRQSKDLESAVKEYRRRYEIPPPPHFDKWFEFARSNNVQLIDEFDAIYNLITPFW
GLKPKTIRARAKEALGNDNALIGVAIRNHQISHMEGGMEWQRNATQGMLDGFLKYLPDMD
LAFNIHDEPRVIVPHDDLTRLVKKAKTENMPASNLVKRPTNDFSKSSPELNDKMIFEQVK
HSRFNSFSRQATWTHSRMSCPPESPARILEEDERWDDLSQYGVSELGFVYNSTAMADICF
SPSLSSTYGFFDRPNTYKVVHDLFPIFSQSKISSYNDIIYPSPWYWYDKVKYKQEEDMPW
DEKDSKLYWRGSTTGGFSRDGGWRRQHRQHFVKKINAGGQAKIVNNQGSQSRPKWAVTEV
SRADYSTLTDVSFSHIGQCDEGDCKAQQAFFNVSSRVNQTDAWGYKYLLDMDGNAFSGRF
LTFLQSMSLTFKFALFREWHNEWLKPWVHYVPLSLQGDDWLETVRFFNESSLGAEDGKNM
AMESREWAAKTMRKEDMEVWFFRLLLE

Enzyme Prediction     

No EC number prediction in KID68410.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	362	627	2.4e-77	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.94e-16	381	627	28	248	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.38e-07	385	627	108	318	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64603.1|GT90	0.0	1	627	1	627
QPH01614.1|GT90	0.0	3	627	20	618
QUC18570.1|GT90	0.0	3	627	3	629
ANH56581.1|GT90	1.19e-298	2	627	3	603
UNI14246.1|GT90	7.18e-298	1	627	10	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	6.63e-08	385	625	154	372	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	3.94e-06	372	627	105	337	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.74e-45	108	627	152	651	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q8T045|RUMI_DROME	3.50e-07	385	625	166	384	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	1.07e-06	385	625	164	382	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	3.14e-06	372	627	133	365	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	5.66e-06	385	625	164	382	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.980261	0.019761

TMHMM  Annotations     

Start	End
7	26