CAZyme Information: KID67564.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID67564.1
• CAZy Family: GH5
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714	AZNF01000004|CGC2	79874.10	6.5464

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000004:2027423-2029851(-)

Full Sequence      

MASQDIFAKPVDTKAPPSRIPVRNDHPVRRKGIQSQAPLQTNKFYSNFFLGDQRCPSFTF
PYSVAWAGGKGVSASWGMSCSHIEENQRVFGEVKFDGASSFYLNPIGIQSMVISAKELGE
ETTLSMDSITAFSARVHLSKNETAQPAISFPLVQGMAYITAQFDGSVPLIQSGVFFKAVS
RVTTNPKEHVTKYNFHLEDGTTWRVYAWRTKGEELDLKVINNNRAESKSPFYGILQVCKD
PGSKGSEDLFDDGAGVYPVTLELSGSVFGQEGSYSFKFQKNGHQLGHLYMFALPHHLSSF
NGETMKQVQEVRLQSTTKGVATLVKGTEWAMVERHMPTEMDFAPWHPENGSMKELSSEAK
GIIRAAAAKELSQNIAAQTNLDSMYFSGKALVKFATILYVVHELLGDEALAKAGLGQLKA
AFGTFAANKQKYPLQDFVAAWGGIVSSASYKTGDDAVDFGNTYYNDHHFHYGYHILAAAT
IGYLDPEWVNANRDYVNLLVRDVANPSEDDKFFPLWRSFDWYHGHSWAHGLYAAMDGKDQ
ESSSEDVMCAYALKMWGRVSKNSDLEMRGNLQLSIISRSLQSYYLYKKDNTVQPQQFIGN
KVAGILFENKIDHTTYFDPNIEAIQGIHMIPILPATPFVRDQGFVREEWEAFFDKGRVDG
IRNAWKGIIYGNYATIEPKKAWEFFTSRDFDPQWLDGGASMTWFMAYSAALGCL

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	30	707	6.9e-215	0.9823151125401929

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	11	712	61	756	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	355	705	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.14e-145	26	347	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI67551.1|GH81	0.0	1	711	1	710
QPG94396.1|GH81	0.0	1	711	143	852
UNI22551.1|GH81	0.0	1	712	1	711
ANH56517.1|GH81	0.0	1	709	1	722
QYS95658.1|GH81	0.0	1	712	12	723

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.42e-87	41	682	43	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.33e-87	41	682	68	719	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.04e-85	41	682	43	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	5.35e-30	315	681	282	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.53e-21	385	681	361	654	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.16e-234	1	709	188	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	3.00e-174	26	712	21	703	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	7.27e-158	3	710	72	777	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.58e-151	11	711	406	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	5.04e-149	5	711	46	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000050

TMHMM  Annotations     

There is no transmembrane helices in KID67564.1.