CAZyme Information: KID67241.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID67241.1
• CAZy Family: GH43|CBM66
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	AZNF01000004|CGC5	29971.30	8.3790

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000004:897189-898079(-)

Full Sequence      

MKTTFAVIAAIIGFASYGSAHMQMSDPPPFLSKFNKFTEQGKQDDSMTSPLLASGSNFPC
KGYHSLVGTPQGQSVATWTPGQSYKMTIAGTATHNGGSCQASLSFDSGKTWKVIHSYVGS
CPLQDGATFAFTVPSDTPAGDALFAWTWFNQLGNREMYMNCAAVTIGGGAKIRKARGDTT
PFSSRPAMFTANIGNGCSTEESKDVVFPDPGSELDTKSDKPAPPAGNCGTKGSGSGSGSA
SAPAPAASGALVNNSNNSAGNPSAPPASAPSPTPVSTAAAASTSKPVGSGGSCRAK

Enzyme Prediction     

No EC number prediction in KID67241.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	21	220	5.5e-69	0.9842931937172775

CDD Domains     

KID67241.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI67181.1|AA11	2.18e-178	1	296	1	298
QUC21080.1|AA11	1.82e-99	1	231	1	232
QPH05754.1|AA11	2.39e-99	1	229	1	226
UNI20223.1|AA11	8.16e-96	4	228	3	226
UPK98992.1|AA11	1.19e-92	9	228	10	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	1.13e-38	21	220	1	205	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

KID67241.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999773	CS pos: 20-21. Pr: 0.9787

TMHMM  Annotations     

Start	End
5	24