CAZyme Information: KID66727.1

Basic Information

• Species: Metarhizium anisopliae
• Lineage: Ascomycota; Sordariomycetes; ; Clavicipitaceae; Metarhizium; Metarhizium anisopliae
• CAZyme ID: KID66727.1
• CAZy Family: GH31
• CAZyme Description: carbohydrate esterase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222		24126.42	9.4967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ManisopliaeARSEF549	10891	1276135	0	10891

• Gene Location: location=AZNF01000005:1742394-1743062(+)

Full Sequence      

MPETDAAKVPLRIMPLGASITYGQGSSTGNGYRNDLHKLLTDSGYTVNMVGSRKHGSMKD
NDVEGWPGFLIDEVQSKAEAAVPSRLPNVFIVNAGTNDSGRNFQLDGAGRRTDDLLEYLW
KASPDSTIILSTLLINLYPVVEARVEKVNAQIKEVARQKAAQKKRIVLVDMHAADGPQKA
DLADATHPNDAGYNKMAKIWFRGIQEAANKGFLKNPKPVPGA

Enzyme Prediction     

No EC number prediction in KID66727.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	11	204	4.3e-60	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.49e-48	11	204	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.27e-16	16	193	2	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.40e-13	16	202	4	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	1.24e-09	13	200	1	224	GDSL-like Lipase/Acylhydrolase.
238872	SGNH_hydrolase_like_2	2.43e-09	40	200	11	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG99528.1|CE3	1.83e-99	6	220	40	255
UNI21161.1|CE0	7.48e-92	2	222	29	257
CAP79838.1|CE0	1.02e-80	5	213	98	306
AEO66483.1|CE0	3.25e-79	9	221	41	255
UKZ67969.1|CE0	4.94e-76	10	218	59	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	1.91e-23	7	202	2	193	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	3.86e-18	2	214	35	265	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KID66727.1.